[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02586.1
DDBJ      :             unknown
Swiss-Prot:Y048_RICCN   RecName: Full=Uncharacterized protein RC0048;

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:440 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->440 PF10871 * DUF2748 0.0 92.5 %
:HMM:PFM   1->440 PF10871 * DUF2748 2.2e-263 70.6 435/447  
:BLT:SWISS 1->440 Y048_RICCN 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02586.1 GT:GENE AAL02586.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(43865..45187) GB:FROM 43865 GB:TO 45187 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL02586.1 GB:DB_XREF GI:15619083 LENGTH 440 SQ:AASEQ MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYKNSASDQKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNPFAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFQLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFKKPKSNFFSKINIFSNKKLVLKPVREL GT:EXON 1|1-440:0| SW:ID Y048_RICCN SW:DE RecName: Full=Uncharacterized protein RC0048; SW:GN OrderedLocusNames=RC0048; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->440|Y048_RICCN|0.0|100.0|440/440| SEG 199->210|aaaarlqiiaaq| SEG 352->364|eieeaiacieala| RP:PFM:NREP 1 RP:PFM:REP 1->440|PF10871|0.0|92.5|440/440|DUF2748| HM:PFM:NREP 1 HM:PFM:REP 1->440|PF10871|2.2e-263|70.6|435/447|DUF2748| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 440-441| PSIPRED ccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcHHcccHHHHccccccEEEEEEHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEEEEEEccEEEEEEEEccHHHHHHHHHHHHcccccccccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccccccccEEEEEccccEEEHHHHHHHHHHHHHHHHcccHHEEEEEcccccccEEEEEEEEEEEEEEHHHccccccccEEEEEEcccHHHHHHHHHHHHHHHHHcccccHHHHHcccccHHHHHHHHHHHHHcccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHccccccccHHHHHHccc //