[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02587.1
DDBJ      :             unknown
Swiss-Prot:Y049_RICCN   RecName: Full=Uncharacterized protein RC0049;

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   58->157 PF07156 * Prenylcys_lyase 0.00016 24.5 98/368  
:BLT:SWISS 1->174 Y049_RICCN e-101 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02587.1 GT:GENE AAL02587.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(45197..45721) GB:FROM 45197 GB:TO 45721 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL02587.1 GB:DB_XREF GI:15619084 LENGTH 174 SQ:AASEQ MIAQNHFKKIAISSTGIRRGVEDFLNQKYFADKFTEEEQGCFVLFLAYKIFRYGNKVCLKYFSEQQPELITKIFDDYPHLFFRREAINICIKNKDGRQKALDAIKLKSSNKFFKDCFDTVFPKVDVVVNLIFEEEPKPKHVPNEPELVFNLELIPLNIDENDDVLPTSNVENNH GT:EXON 1|1-174:0| SW:ID Y049_RICCN SW:DE RecName: Full=Uncharacterized protein RC0049; SW:GN OrderedLocusNames=RC0049; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->174|Y049_RICCN|e-101|100.0|174/100| HM:PFM:NREP 1 HM:PFM:REP 58->157|PF07156|0.00016|24.5|98/368|Prenylcys_lyase| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---111--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 167-174| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccccEEEEccccHHHHHHHHHHcccHHHHHHHHHccccccccccccEEEEEEEEEEEEEEcccccccccccccccc //