[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02634.1
DDBJ      :             unknown
Swiss-Prot:Y096_RICCN   RecName: Full=Uncharacterized protein RC0096;

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.52
:224 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  142->223 1utaA  d.58.52.1 * 3e-10 14.1 %
:HMM:SCOP  142->225 1utaA_ d.58.52.1 * 0.00042 17.8 %
:RPS:PFM   147->224 PF05036 * SPOR 2e-04 32.9 %
:HMM:PFM   144->222 PF05036 * SPOR 3.3e-14 26.8 71/76  
:HMM:PFM   10->31 PF09976 * DUF2133 0.0001 22.7 22/43  
:HMM:PFM   91->169 PF10174 * Cast 7.2e-05 23.1 78/775  
:BLT:SWISS 1->224 Y096_RICCN e-127 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02634.1 GT:GENE AAL02634.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 89390..90064 GB:FROM 89390 GB:TO 90064 GB:DIRECTION + GB:PRODUCT unknown GB:PROTEIN_ID AAL02634.1 GB:DB_XREF GI:15619135 LENGTH 224 SQ:AASEQ MINNIFIKIFLVFLVCMSAIYFGYQYYQNSKPVITIYPDELPTKIKPSIIENNQIAAVHSTIYENLIAKDTNIKTVKLLPDPEKPMSIDSRNQSQSDESFDEISNLIALIEPNNNAKNETDLNIIKLEKGSKDKVSNAKNCKNNESYKVQLGSVKSEAEAMKEGERIKKQFPKILKNVVITTKKVKYDDGKFFYLILAGDYGSLSQAKAVCKKLAYNKQSCVLK GT:EXON 1|1-224:0| SW:ID Y096_RICCN SW:DE RecName: Full=Uncharacterized protein RC0096; SW:GN OrderedLocusNames=RC0096; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->224|Y096_RICCN|e-127|100.0|224/224| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 3->24| RP:PFM:NREP 1 RP:PFM:REP 147->224|PF05036|2e-04|32.9|70/76|SPOR| HM:PFM:NREP 3 HM:PFM:REP 144->222|PF05036|3.3e-14|26.8|71/76|SPOR| HM:PFM:REP 10->31|PF09976|0.0001|22.7|22/43|DUF2133| HM:PFM:REP 91->169|PF10174|7.2e-05|23.1|78/775|Cast| RP:SCP:NREP 1 RP:SCP:REP 142->223|1utaA|3e-10|14.1|71/77|d.58.52.1| HM:SCP:REP 142->225|1utaA_|0.00042|17.8|73/0|d.58.52.1|1/1|Sporulation related repeat| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 87-99, 152-168| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHEEccccEEEEccccccccccccEEccccHHHHHHHHHHHHHccccccEEEEEcccccccEEEEcccccccHHHHHHHHHHHEEEccccccccccccHHHHHHHHHHHHccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEc //