[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02653.1
DDBJ      :             unknown
Swiss-Prot:Y115_RICCN   RecName: Full=Uncharacterized protein RC0115;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->62 Y115_RICCN 1e-31 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02653.1 GT:GENE AAL02653.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 115165..115353 GB:FROM 115165 GB:TO 115353 GB:DIRECTION + GB:PRODUCT unknown GB:PROTEIN_ID AAL02653.1 GB:DB_XREF GI:15619157 LENGTH 62 SQ:AASEQ MTTNRVDPLEQTSPNTPTSKREKAKIYGKKLVDSAKIGAKTLSNAYKVTIGTIEVVGPGSDF GT:EXON 1|1-62:0| SW:ID Y115_RICCN SW:DE RecName: Full=Uncharacterized protein RC0115; SW:GN OrderedLocusNames=RC0115; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->62|Y115_RICCN|1e-31|100.0|62/100| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 8-25, 60-62| PSIPRED cccccccccccccccccccccHHHHHHHHHHHccccccHHHcccEEEEEEEEEEEEcccccc //