[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02663.1
DDBJ      :             ribose-phosphate pyrophosphokinase-like protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  854/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
c.61.1
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->112 3dahC PDBj 5e-20 42.9 %
:RPS:PDB   1->110 1dkuA PDBj 2e-28 39.1 %
:RPS:SCOP  1->61 1dkrA1  c.61.1.2 * 2e-16 46.7 %
:RPS:SCOP  71->105 1dkrA2  c.61.1.2 * 2e-06 37.1 %
:HMM:SCOP  1->66 2c4kA1 c.61.1.2 * 1.4e-13 42.4 %
:HMM:SCOP  39->105 1bzyA_ c.61.1.1 * 7.3e-06 23.9 %
:BLT:SWISS 1->111 KPRS_OCEIH 5e-21 45.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02663.1 GT:GENE AAL02663.1 GT:PRODUCT ribose-phosphate pyrophosphokinase-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 122822..123172 GB:FROM 122822 GB:TO 123172 GB:DIRECTION + GB:PRODUCT ribose-phosphate pyrophosphokinase-like protein GB:PROTEIN_ID AAL02663.1 GB:DB_XREF GI:15619167 LENGTH 116 SQ:AASEQ MPYFGYARQDNINSQNIIPAKLIADFLEKLGVNHVITIDLHSDKIEQFFNIPVSNLEPINLYIPFLSTYSNFVIVTPDKGSINRVQKISNLLNIDSAYINKERDINNNCEIDINHK GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 1->111|KPRS_OCEIH|5e-21|45.8|107/317| BL:PDB:NREP 1 BL:PDB:REP 1->112|3dahC|5e-20|42.9|112/300| RP:PDB:NREP 1 RP:PDB:REP 1->110|1dkuA|2e-28|39.1|110/295| RP:SCP:NREP 2 RP:SCP:REP 1->61|1dkrA1|2e-16|46.7|60/157|c.61.1.2| RP:SCP:REP 71->105|1dkrA2|2e-06|37.1|35/141|c.61.1.2| HM:SCP:REP 1->66|2c4kA1|1.4e-13|42.4|66/0|c.61.1.2|1/2|PRTase-like| HM:SCP:REP 39->105|1bzyA_|7.3e-06|23.9|67/214|c.61.1.1|1/1|PRTase-like| OP:NHOMO 1581 OP:NHOMOORG 1046 OP:PATTERN -----------------1--------------111--------------------------------- 11112-1111111111111-11111111111111111111122122111111111--11111111111111-111111111111111111111111-1111111111111--------11----1111111111112223311122111-111111111---111112111--11-11--1-11112211111111111111111111121111111111111112222221211111111111111-11111222222221222222221222212222222222222222222222222222222222222221222222211111111111111111111111-1-1-1--1111111111111111112111111111111121111111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---111-111--11-111111111111111111111111111111111111111111111111111111111111111111111111111111211112111111111111111111111111121121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111--------1111111111111111111111--1----1-11111111111111111111111111111-21 11--332-94312333233233333233334233333323333312233333433332223342433313333335444434443433-22122222222232556-22136B5344-12335377144LQ6-46A423261453342235328154432332222283433522211-8--1113123342112221- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 100.0 SQ:SECSTR EcccTTTTcccccTTcccHHHHHHHHHHHHTccEEEEEccccGGGGGGccccEEEEccHHHHHHHHTTcccEEEEEccGGGHHHHHHHHHHTTccEEEEEcccEEEcccTccTTcE DISOP:02AL 115-116| PSIPRED cccccccHHHHccccccEEHHHHHHHHHHccccEEEEEEccccccccccccccccccHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHcccEEEEEEEEccccEEEEEEccc //