[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02667.1
DDBJ      :             ABC transporter permease protein
Swiss-Prot:Y129_RICCN   RecName: Full=UPF0393 membrane protein RC0129;

Homologs  Archaea  0/68 : Bacteria  576/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
:259 amino acids
:PSIPRED
:RPS:PFM   43->239 PF02405 * DUF140 7e-41 50.3 %
:HMM:PFM   44->256 PF02405 * DUF140 6.4e-82 50.7 213/215  
:BLT:SWISS 1->259 Y129_RICCN e-109 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02667.1 GT:GENE AAL02667.1 GT:PRODUCT ABC transporter permease protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 124807..125586 GB:FROM 124807 GB:TO 125586 GB:DIRECTION + GB:PRODUCT ABC transporter permease protein GB:PROTEIN_ID AAL02667.1 GB:DB_XREF GI:15619171 LENGTH 259 SQ:AASEQ MLFNIANSVGKRTVKFAQSVGSFSLFSFAAVSSIIRPPLYLSLIIRQLLFIGFHSLPVVAMTTFFSGAVLALQSYIGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEIATMRVTEQIDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLVGVYKLDFNSAAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILISNYLITELFFKV GT:EXON 1|1-259:0| SW:ID Y129_RICCN SW:DE RecName: Full=UPF0393 membrane protein RC0129; SW:GN OrderedLocusNames=RC0129; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->259|Y129_RICCN|e-109|100.0|259/259| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 13->35| TM:REGION 47->69| TM:REGION 93->115| TM:REGION 150->172| TM:REGION 198->219| TM:REGION 237->259| SEG 19->33|svgsfslfsfaavss| SEG 209->226|gfiisiiscysgyysgkg| SEG 240->252|nssililisnyli| RP:PFM:NREP 1 RP:PFM:REP 43->239|PF02405|7e-41|50.3|197/215|DUF140| HM:PFM:NREP 1 HM:PFM:REP 44->256|PF02405|6.4e-82|50.7|213/215|DUF140| OP:NHOMO 919 OP:NHOMOORG 594 OP:PATTERN -------------------------------------------------------------------- 111-----------22311-17--351111137686875B----------------------3-143222-------------121111111-1111--11211132222-------111----111111111131----------1122112111111111122111121111111111111-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2313221-----212222-22222211111111111-111111111121111111111111122212122222111222222222222222311111111111111111111111111111-112122222122222222222222322222222222222222221222222222222221212111111122323252321123233223213133352212124434111-1111111111111111121112211212-111121111123111111111111--11222------11111111111111111-1111111111111111111121111111111111111111111111111111-211111111111--1-1111122222-1111111111111111111111111---212222222222222211122222222211111111111212122222222222222---1221111----------------------------------------------121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------11117111111122-31--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //