[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02672.1
DDBJ      :             unknown
Swiss-Prot:Y134_RICCN   RecName: Full=Uncharacterized protein RC0134;

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.194.1
:165 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  37->160 2f9zC1  d.194.1.3 * 5e-09 22.3 %
:HMM:PFM   97->150 PF04773 * FecR 0.00053 19.2 52/98  
:BLT:SWISS 1->165 Y134_RICCN 9e-93 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02672.1 GT:GENE AAL02672.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(127873..128370) GB:FROM 127873 GB:TO 128370 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL02672.1 GB:DB_XREF GI:15619177 LENGTH 165 SQ:AASEQ MARLALGAAYKTQNRKENSIAQYAYSYSLQQGIVDYEAVRVEQHKVGFSDQEKIGTDNIQQCVAVILHDPLTKKTALAHVDRFTYAGSLTHDVISNFPPNTQLEAYLVGGRDRSAVSISVSDGNIRKVTQELTNHFNVNIKSADIEDKGAPLGIIFDPITSNCSG GT:EXON 1|1-165:0| SW:ID Y134_RICCN SW:DE RecName: Full=Uncharacterized protein RC0134; SW:GN OrderedLocusNames=RC0134; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->165|Y134_RICCN|9e-93|100.0|165/165| HM:PFM:NREP 1 HM:PFM:REP 97->150|PF04773|0.00053|19.2|52/98|FecR| RP:SCP:NREP 1 RP:SCP:REP 37->160|2f9zC1|5e-09|22.3|121/152|d.194.1.3| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 4-6, 164-165| PSIPRED ccccccccHHHcccccHHHHHHHHHHHHHHHccccHHHHEEHHHcccccccHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHcccccccEEEEEEccccccEEEEEEcccHHHHHHHHHHHHEEEEEEEcccccccccEEEEEccccccccc //