[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02688.1
DDBJ      :             acetate kinase (AckA)-like protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  704/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:122 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->113 1tuuA PDBj 6e-25 43.4 %
:RPS:PDB   1->117 2e1zA PDBj 2e-29 40.2 %
:RPS:SCOP  1->119 1g99A2  c.55.1.2 * 9e-17 42.0 %
:HMM:SCOP  1->117 1g99A2 c.55.1.2 * 8.2e-38 53.0 %
:RPS:PFM   1->117 PF00871 * Acetate_kinase 2e-28 50.4 %
:HMM:PFM   1->118 PF00871 * Acetate_kinase 9.1e-40 44.9 118/388  
:BLT:SWISS 1->117 ACKA_RICFE 2e-59 95.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02688.1 GT:GENE AAL02688.1 GT:PRODUCT acetate kinase (AckA)-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 151180..151548 GB:FROM 151180 GB:TO 151548 GB:DIRECTION + GB:PRODUCT acetate kinase (AckA)-like protein GB:PROTEIN_ID AAL02688.1 GB:DB_XREF GI:15619195 LENGTH 122 SQ:AASEQ MGFSVLDGVMMGTRTGNLDPGVVLYLIDHEQMTTKAVTELLYKKSGLLGMSSESSDMRTLLASNSPDAKFAIDLFVYRIVLEIGKLTAALEGVDCLIFTAGVGQNSTVIREMITEKLFMARH GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 1->117|ACKA_RICFE|2e-59|95.7|117/385| TM:NTM 1 TM:REGION 67->89| BL:PDB:NREP 1 BL:PDB:REP 1->113|1tuuA|6e-25|43.4|113/399| RP:PDB:NREP 1 RP:PDB:REP 1->117|2e1zA|2e-29|40.2|117/394| RP:PFM:NREP 1 RP:PFM:REP 1->117|PF00871|2e-28|50.4|117/387|Acetate_kinase| HM:PFM:NREP 1 HM:PFM:REP 1->118|PF00871|9.1e-40|44.9|118/388|Acetate_kinase| GO:PFM:NREP 5 GO:PFM GO:0005622|"GO:intracellular"|PF00871|IPR000890| GO:PFM GO:0008152|"GO:metabolic process"|PF00871|IPR000890| GO:PFM GO:0016301|"GO:kinase activity"|PF00871|IPR000890| GO:PFM GO:0016310|"GO:phosphorylation"|PF00871|IPR000890| GO:PFM GO:0016774|"GO:phosphotransferase activity, carboxyl group as acceptor"|PF00871|IPR000890| RP:SCP:NREP 1 RP:SCP:REP 1->119|1g99A2|9e-17|42.0|119/201|c.55.1.2| HM:SCP:REP 1->117|1g99A2|8.2e-38|53.0|117/242|c.55.1.2|1/1|Actin-like ATPase domain| OP:NHOMO 912 OP:NHOMOORG 734 OP:PATTERN --------------------------------------------------111--------------- 1-2-111111111111111-11--1111111111111111-11111111-11-11111--11--1-1111111111111112------11111111--1-11--11------------------111-1---1111----------121111111111---1--111111-------------111--111-11111111111111111111111111111-1112222221111111111111111111111143122112223322223222212221111111111111111111111111111111111211111111111111111111111111111222111111111-1111-1111121111111-21--2-----122233111611211111111111-37233212111-1---1112111121--12-111111-111111111111--1-4-------------111-11--1--1----------1111-11111111-1132111111-11431221--11-2--1113-11-1-111--212222222111213-2--11111-111112221223323233---13111111111111-1--1--1---11-22511-1-1-211111112111111111211-1111-11111121111211112111211-11111121111211111122221111122222222222222221111111111311111111111--11-----11111-1-111111111111111111111-11113-1111----1----21--111111111-22222222212222-----------------1------1111111111111111-211111111111111111111211111111-- --------------1--------1111-------1--------1----11-111------------------------------------------------------1-------------------------------------------------1----1------------22-----111--1--11-1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 96.7 SQ:SECSTR ccccTTcccccccccccccHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHcccccHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHTTcccccEEEEEHHHHHHcHHHHHHHHHTTG#### PSIPRED ccccHHHccccccccccccHHHHHHHHHHccccHHHHHHHHHccccHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHcccc //