[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02753.1
DDBJ      :             prolyl endopeptidase-like protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  273/915 : Eukaryota  103/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:98 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->98 2bklB PDBj 2e-25 51.6 %
:RPS:PDB   9->96 1e5tA PDBj 1e-13 47.7 %
:RPS:SCOP  10->98 1e5tA2  c.69.1.4 * 2e-28 47.2 %
:HMM:SCOP  4->96 1xfdA2 c.69.1.24 * 4.2e-15 29.0 %
:RPS:PFM   10->96 PF00326 * Peptidase_S9 1e-15 41.4 %
:HMM:PFM   5->97 PF00326 * Peptidase_S9 1.9e-30 44.1 93/213  
:BLT:SWISS 1->98 Y174_RICPR 1e-45 84.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02753.1 GT:GENE AAL02753.1 GT:PRODUCT prolyl endopeptidase-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(225636..225932) GB:FROM 225636 GB:TO 225932 GB:DIRECTION - GB:PRODUCT prolyl endopeptidase-like protein GB:PROTEIN_ID AAL02753.1 GB:DB_XREF GI:15619267 LENGTH 98 SQ:AASEQ MENEVWVKHGRVSVLANIRGGGEFGPEWHEATQGIKRQTGLNDFIAVAEDLIKQNITSPEYLGIKGGSHGGLLVSVAMTQCPDLFGAIACEVPILDTI GT:EXON 1|1-98:0| BL:SWS:NREP 1 BL:SWS:REP 1->98|Y174_RICPR|1e-45|84.7|98/722| BL:PDB:NREP 1 BL:PDB:REP 6->98|2bklB|2e-25|51.6|93/677| RP:PDB:NREP 1 RP:PDB:REP 9->96|1e5tA|1e-13|47.7|88/710| RP:PFM:NREP 1 RP:PFM:REP 10->96|PF00326|1e-15|41.4|87/208|Peptidase_S9| HM:PFM:NREP 1 HM:PFM:REP 5->97|PF00326|1.9e-30|44.1|93/213|Peptidase_S9| GO:PFM:NREP 2 GO:PFM GO:0006508|"GO:proteolysis"|PF00326|IPR001375| GO:PFM GO:0008236|"GO:serine-type peptidase activity"|PF00326|IPR001375| RP:SCP:NREP 1 RP:SCP:REP 10->98|1e5tA2|2e-28|47.2|89/280|c.69.1.4| HM:SCP:REP 4->96|1xfdA2|4.2e-15|29.0|93/0|c.69.1.24|1/1|alpha/beta-Hydrolases| OP:NHOMO 640 OP:NHOMOORG 383 OP:PATTERN ------------------------------------------------------1111111------- 332-11222221-11-122-21--22222221211122221--1122-122-111----1111-111--111---------------------------2231131-2-1---------------11--1111-1111111-----111111-11-----------42211------------1-1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-122231111111111---11-1111111111111---2--2-2111-2--12232221111111-------------------113--1-------------11111221-2222-----222221----11111111111111-1111-1111---------1--------1--------2-1111111------1---------------------------42-----------------------------1111--2212-2122211122221223211-----1--------1-----------------------------------------------------------2------------------------1------------1--------------------------1-1111-1111---1-111-----------22111111442221111111111----------------------2--------------------------------------1- ----222-423-334--1----------------------------------1------------------------------------111--112-2-11-11--1422252241212112134171BC4143311126-2122111-2211-11111121-11-211---12-222H1-1238567-432233432 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 100.0 SQ:SECSTR GcTHHHHHHccEEEEEccTTccTTHHHHHHTTcGGGTHHHHHHHHHHHHHHHHTTcccGGGEEEEEETHHHHHHHHHHHHcGGGccEEEEEcccccGT PSIPRED cHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHEEEEEEcHHHHHHHHHHHcccccEEEEEEcccccccc //