[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02755.1
DDBJ      :             prolyl endopeptidase-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->46 Y174_RICPR 1e-16 71.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02755.1 GT:GENE AAL02755.1 GT:PRODUCT prolyl endopeptidase-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(226648..226809) GB:FROM 226648 GB:TO 226809 GB:DIRECTION - GB:PRODUCT prolyl endopeptidase-like protein GB:PROTEIN_ID AAL02755.1 GB:DB_XREF GI:15619269 LENGTH 53 SQ:AASEQ MHQEEVTDSLYPSLLYIWKRGEPIEKAKKLFEIPKNYIRVSASKLLPIIFLHL GT:EXON 1|1-53:0| BL:SWS:NREP 1 BL:SWS:REP 1->46|Y174_RICPR|1e-16|71.7|46/100| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHccccEEEEEcccccHHHHHHHHHccHHHEEEccccHHHHHEEcc //