[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02825.1
DDBJ      :             unknown
Swiss-Prot:Y215_RICPR   RecName: Full=Uncharacterized protein RP215;

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->90 PF10877 * DUF2671 1e-39 98.9 %
:HMM:PFM   1->90 PF10877 * DUF2671 6.1e-65 97.8 90/90  
:BLT:SWISS 1->90 Y215_RICPR 5e-45 90.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02825.1 GT:GENE AAL02825.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 291606..291878 GB:FROM 291606 GB:TO 291878 GB:DIRECTION + GB:PRODUCT unknown GB:PROTEIN_ID AAL02825.1 GB:DB_XREF GI:15619345 LENGTH 90 SQ:AASEQ MQEKELSNNFLEEQEKSKEDDSPFFDVKYICQASLLITDSIRKGYDVTQLPNGDINVTEVRIVNVHYNWNSEKGKFVKTNQIEFNNSKGG GT:EXON 1|1-90:0| SW:ID Y215_RICPR SW:DE RecName: Full=Uncharacterized protein RP215; SW:GN OrderedLocusNames=RP215; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->90|Y215_RICPR|5e-45|90.0|90/100| RP:PFM:NREP 1 RP:PFM:REP 1->90|PF10877|1e-39|98.9|90/90|DUF2671| HM:PFM:NREP 1 HM:PFM:REP 1->90|PF10877|6.1e-65|97.8|90/90|DUF2671| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-18, 85-90| PSIPRED ccccHHHHHHHHHHHHccccccccccEEEEEEEEEEEEEcccccccEEEcccccEEEEEEEEEEEEEEcccccccEEEEEEEEEcccccc //