[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02862.1
DDBJ      :             unknown
Swiss-Prot:Y324_RICCN   RecName: Full=Uncharacterized protein RC0324;

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->88 PF11020 * DUF2610 1e-32 70.2 %
:HMM:PFM   4->87 PF11020 * DUF2610 2.7e-44 61.9 84/85  
:BLT:SWISS 1->107 Y324_RICCN 4e-52 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02862.1 GT:GENE AAL02862.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 325691..326014 GB:FROM 325691 GB:TO 326014 GB:DIRECTION + GB:PRODUCT unknown GB:PROTEIN_ID AAL02862.1 GB:DB_XREF GI:15619385 LENGTH 107 SQ:AASEQ MAHYKEFEFDCDFSGQRAKFKFYIGTPQEGHHPLQFQAKWLSDERGGTIPDDVMKAISQLNDLAKKNGVPLPDLCVYALGSAQEVQATPQDEDENESENQEDKAEQA GT:EXON 1|1-107:0| SW:ID Y324_RICCN SW:DE RecName: Full=Uncharacterized protein RC0324; SW:GN OrderedLocusNames=RC0324; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->107|Y324_RICCN|4e-52|100.0|107/107| SEG 90->102|qdedenesenqed| RP:PFM:NREP 1 RP:PFM:REP 5->88|PF11020|1e-32|70.2|84/85|DUF2610| HM:PFM:NREP 1 HM:PFM:REP 4->87|PF11020|2.7e-44|61.9|84/85|DUF2610| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-11111111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 86-107| PSIPRED ccccEEEEEEcccccccccEEEEEccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccccccccHHcccccccccc //