[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02934.1
DDBJ      :             unknown
Swiss-Prot:Y396_RICCN   RecName: Full=Putative uncharacterized protein RC0396;

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->69 PF04860 * Phage_portal 2.9e-07 38.9 36/347  
:BLT:SWISS 1->94 Y396_RICCN 8e-52 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02934.1 GT:GENE AAL02934.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 396624..396908 GB:FROM 396624 GB:TO 396908 GB:DIRECTION + GB:PRODUCT unknown GB:PROTEIN_ID AAL02934.1 GB:DB_XREF GI:15619463 LENGTH 94 SQ:AASEQ MIKNYRKKFWKNSTTKSQNFIELNDIAYGNLIRVDIEAYRENVIVYRCINLIAQSAGHVPWKVLKSKTGEVIFRLSGALFTNKTESQKSRSGFC GT:EXON 1|1-94:0| SW:ID Y396_RICCN SW:DE RecName: Full=Putative uncharacterized protein RC0396; SW:GN OrderedLocusNames=RC0396; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->94|Y396_RICCN|8e-52|100.0|94/94| HM:PFM:NREP 1 HM:PFM:REP 34->69|PF04860|2.9e-07|38.9|36/347|Phage_portal| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-11---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 83-92| PSIPRED cccHHHHHHHccccccccccEEEcccccccEEEEEHHHHHcccHHHHHHHHHHHcccccEEEEEcccccEEEEEEcccEEcccccccccccccc //