[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02983.1
DDBJ      :             unknown
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->170 3ciaB PDBj 6e-10 16.6 %
:HMM:SCOP  2->166 1hs6A3 d.92.1.13 * 5e-07 14.9 %
:RPS:PFM   9->54 PF05299 * Peptidase_M61 8e-04 45.7 %
:HMM:PFM   5->69 PF05299 * Peptidase_M61 4.4e-10 38.5 65/122  
:BLT:SWISS 107->169 MYOM_DICDI 7e-05 30.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02983.1 GT:GENE AAL02983.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 439793..440308 GB:FROM 439793 GB:TO 440308 GB:DIRECTION + GB:PRODUCT unknown GB:PROTEIN_ID AAL02983.1 GB:DB_XREF GI:15619516 LENGTH 171 SQ:AASEQ MDKQDYITLLAHEHLHNCTGKKIRNNLERLNYWWSEGLTDYYSRVLALRSSVITLEEFVEEFNKFFENYYLSPVINEPNNLIETDYWQDYAVQRLPYYCGFVLALYLDNFIKENNKSKSLDNVMLDLFKTSKEQEFSSDYFKTIVKNYVPKGIDKEINEYIEQGKTIDLNY GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 107->169|MYOM_DICDI|7e-05|30.2|63/1737| SEG 56->68|eefveefnkffen| RP:PDB:NREP 1 RP:PDB:REP 1->170|3ciaB|6e-10|16.6|169/581| RP:PFM:NREP 1 RP:PFM:REP 9->54|PF05299|8e-04|45.7|46/121|Peptidase_M61| HM:PFM:NREP 1 HM:PFM:REP 5->69|PF05299|4.4e-10|38.5|65/122|Peptidase_M61| HM:SCP:REP 2->166|1hs6A3|5e-07|14.9|161/252|d.92.1.13|1/1|Metalloproteases ("zincins"), catalytic domain| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------1-------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------1-11111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 99.4 SQ:SECSTR cccccTTHHHHHHHHHTTcTTTEEEc#cTTcTHHHHHHHHHHHHHHHHHHHcHHHHcHHHHHHHHHHHHHHccTTTTccccccTTcccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHTTEEEcHHHHHHHHHHTTTTTcTTcccHHHHHHHHHccccccccE DISOP:02AL 171-172| PSIPRED ccHHHHHHHHHHHHHHHccccEEcccccccccEEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHccccccccc //