[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02988.1
DDBJ      :             DNA processing protein Smf-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  495/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.129.1
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->67 2rimA PDBj 9e-04 32.7 %
:RPS:PDB   2->52 3bq9A PDBj 3e-06 0.0 %
:RPS:SCOP  1->61 1wekA  c.129.1.1 * 1e-10 15.3 %
:HMM:SCOP  2->63 1wekA_ c.129.1.1 * 2.5e-07 36.7 %
:RPS:PFM   1->51 PF02481 * DNA_processg_A 2e-13 62.7 %
:HMM:PFM   1->52 PF02481 * DNA_processg_A 1.2e-17 61.5 52/212  
:BLT:SWISS 1->64 SMF_HAEIN 5e-15 56.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02988.1 GT:GENE AAL02988.1 GT:PRODUCT DNA processing protein Smf-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(445193..445528) GB:FROM 445193 GB:TO 445528 GB:DIRECTION - GB:PRODUCT DNA processing protein Smf-like protein GB:PROTEIN_ID AAL02988.1 GB:DB_XREF GI:15619521 LENGTH 111 SQ:AASEQ MVVEASLKSGSLITAKFALEQNRAIFAVPGFPLDPKCQGTNKLIREGAYLVESVDDIVANLPQYEEFMKKDDGLFKDFVELGTVNTRYVKEPSQKERTACYIGIIIGSTHK GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 1->64|SMF_HAEIN|5e-15|56.2|64/373| BL:PDB:NREP 1 BL:PDB:REP 10->67|2rimA|9e-04|32.7|55/368| RP:PDB:NREP 1 RP:PDB:REP 2->52|3bq9A|3e-06|0.0|51/446| RP:PFM:NREP 1 RP:PFM:REP 1->51|PF02481|2e-13|62.7|51/209|DNA_processg_A| HM:PFM:NREP 1 HM:PFM:REP 1->52|PF02481|1.2e-17|61.5|52/212|DNA_processg_A| GO:PFM:NREP 1 GO:PFM GO:0009294|"GO:DNA mediated transformation"|PF02481|IPR003488| RP:SCP:NREP 1 RP:SCP:REP 1->61|1wekA|1e-10|15.3|59/208|c.129.1.1| HM:SCP:REP 2->63|1wekA_|2.5e-07|36.7|60/0|c.129.1.1|1/1|MoCo carrier protein-like| OP:NHOMO 496 OP:NHOMOORG 496 OP:PATTERN -------------------------------------------------------------------- --1-------------------------------------------------------------------------------------------------1-------------------------111--11111111111111--------------------------------------1111111--1------1111111111-111-1111111---1111111-1------------------------11-1-------11---11---1----------111-1111111----------------111----1-1111111111111-111111--1111-111111111-11111111----1-111111111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111111111111111-111-11------1-11-11111------------1111--11111111--1111---111111111111111111111111111111111111-1111---111---1111111111------11-------------------------11111-111-1111111111111111111111--11111-------1111111111111111-11111111-11111111111111111111-111111111111111111111--1111111-1111----1111111111111111111111111111111111-1---11111111111111111111----11--111111111111111---1-11---1111--1--------------------------------------------1------1--1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 60.4 SQ:SECSTR EEccccHHHHHHHHHHHHHHTcGGGTTccccEEEEEcGGGHHHHHHHHHHHHGccEEEHHHHHHHHH############################################ DISOP:02AL 109-111| PSIPRED cEEcccccccHHHHHHHHHHcccEEEEEccccccHHHccHHHHHHcccEEEccHHHHHHHHHHHHcccccccHHHcccccccccccccccccccccHHEEEcccEEEcccc //