[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03081.1
DDBJ      :             protocatechuate-3,4-dioxygenase, beta subunit-like protein
Swiss-Prot:Y543_RICCN   RecName: Full=Putative dioxygenase RC0543;         EC=1.13.11.-;

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.3.6
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->139 3pcdM PDBj 2e-09 40.0 %
:RPS:PDB   25->202 2bumB PDBj 2e-22 24.6 %
:RPS:SCOP  63->202 1s9aA  b.3.6.1 * 5e-23 25.6 %
:HMM:SCOP  8->209 3pccM_ b.3.6.1 * 9.1e-22 22.1 %
:RPS:PFM   63->139 PF00775 * Dioxygenase_C 4e-06 35.8 %
:HMM:PFM   60->140 PF00775 * Dioxygenase_C 8.5e-13 29.6 71/183  
:BLT:SWISS 1->208 Y543_RICCN e-123 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03081.1 GT:GENE AAL03081.1 GT:PRODUCT protocatechuate-3,4-dioxygenase, beta subunit-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 533248..533874 GB:FROM 533248 GB:TO 533874 GB:DIRECTION + GB:PRODUCT protocatechuate-3,4-dioxygenase, beta subunit-like protein GB:PROTEIN_ID AAL03081.1 GB:DB_XREF GI:15619622 LENGTH 208 SQ:AASEQ MKKFIFCFLCLWTLNIFAASKTYPNKLNRCKITRNIFNDYEPKVFETTNNLLRKTGRLSKFYGERILIKGKVLDQNCVPVADAKVYLWQAGSGGKYPYEPLKTRVDKRRFTSKSDSSFTGSGIATTNNKGEYYFISMLPYTSSRYLRSANIRIEHPSLTTLETRLDLSDQNMCDNECGEVNPILIEPQENMPSYCFDLVLQGTTLKRY GT:EXON 1|1-208:0| SW:ID Y543_RICCN SW:DE RecName: Full=Putative dioxygenase RC0543; EC=1.13.11.-; SW:GN OrderedLocusNames=RC0543; SW:KW Complete proteome; Dioxygenase; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->208|Y543_RICCN|e-123|100.0|208/208| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 63->139|3pcdM|2e-09|40.0|70/233| RP:PDB:NREP 1 RP:PDB:REP 25->202|2bumB|2e-22|24.6|171/238| RP:PFM:NREP 1 RP:PFM:REP 63->139|PF00775|4e-06|35.8|67/153|Dioxygenase_C| HM:PFM:NREP 1 HM:PFM:REP 60->140|PF00775|8.5e-13|29.6|71/183|Dioxygenase_C| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF00775|IPR000627| GO:PFM GO:0006725|"GO:cellular aromatic compound metabolic process"|PF00775|IPR000627| GO:PFM GO:0008199|"GO:ferric iron binding"|PF00775|IPR000627| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00775|IPR000627| RP:SCP:NREP 1 RP:SCP:REP 63->202|1s9aA|5e-23|25.6|129/256|b.3.6.1| HM:SCP:REP 8->209|3pccM_|9.1e-22|22.1|195/0|b.3.6.1|1/1|Aromatic compound dioxygenase| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111-1------1-----------------------11111111--1111111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 85.6 SQ:SECSTR ########################cccccccccHHHccccGGGccTTTTcTTTTTcccccccccEEEEEEEEEETTcccccccEEEEEcccTTcccccTTEEcccTTccccccccTTcccEEEEEccTTcEEEEEEEcccEEEcccTTEEEEEEcccGGGEEEEEEETTcGGGGGcTTHHHHTTEEETTTcEEEEccEEEcc###### DISOP:02AL 206-208| PSIPRED cHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEccccccccccEEEEEEEEEEccccccccccEEEEEEccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEEEEEcccccccccEEEEEcccccEEEEEEEccccHHcccHHHcccHHHHHHHHcccEEEEEEEEccEEEEcc //