[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03088.1
DDBJ      :             unknown
Swiss-Prot:Y550_RICCN   RecName: Full=Uncharacterized protein RC0550;

Homologs  Archaea  0/68 : Bacteria  112/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1c.52.1
:838 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->67 2e3lA PDBj 8e-08 27.1 %
:RPS:SCOP  556->741 1w36B3  c.52.1.24 * 3e-20 11.4 %
:HMM:SCOP  200->518 1w36C2 c.37.1.19 * 5e-11 17.6 %
:HMM:SCOP  554->723 1w36B3 c.52.1.24 * 2.4e-05 16.7 %
:BLT:SWISS 1->838 Y550_RICCN 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03088.1 GT:GENE AAL03088.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(540798..543314) GB:FROM 540798 GB:TO 543314 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL03088.1 GB:DB_XREF GI:15619629 LENGTH 838 SQ:AASEQ MTADYSFLKSFAEYIIDKLGKDTKVQIILPNNFSCLELKKILTDKYKIKLPIIIPFNSLISKKIDSDYISKIEELLILSSIITEYKELPLNKNESLKAAELLRKLFNDLIINNIDIKLIEVYNNSNYWQKIYKFLEYCFLRWQEEISFTQKQTKAVYKLKLLQEEIIKIKTGHKQVILAGIFKPNVFFKRFEEELKDYIIHYNPASKQISDGISYYEPNDIYEETKQISYICSRNKDRRIAIVTNNNKLKRVYCNFLDKYEDLLGNDLRLTNIGELLTSIIKILCNNFDLKLLFLLLKNPLINCPTVQQLELMLSNKNRFISSPKYLLQLQFDNEDIREYCRNLIDILFTDTPHNIQAILTLTKEITEKLLPTIWEKEGGAELLEFLTNLTAYSKYINSTDKKDFPKIFSFLLSNIKYYKNTDAASIIIGRPEDLALCEFDLIILPHFNNENWTLSAKAHPWLSKQALQILNIDYDEIAPTLYSDYFNLFLQNKQIVILNAKKYDGKLSVPSNLFLKLEKGSVSPRDLITGSSNYMDTVVKPRYDKSIEIHSPSFPTTLSVTEIETLIKNPYGFYAKKILGLRKKDHIWEEPKISDFGNLIHKVLEEYSKNYDKQYINLNLLDKQNALINIGNHILYSTILPSYTKKTWQIKLTAFSKAFILFDIERRKNCKEIYFETKGELRLNIVGQDIKIIGIADRIEISKSNNITILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFTKCNSLSLLCHPQPLLCYSRESRNPVINNNITIAYVKITSTEPYVHTTEITLSIETLNRHKAGLVKLLEHYITNQFFSYDLNLSKYNDYLHLSR GT:EXON 1|1-838:0| SW:ID Y550_RICCN SW:DE RecName: Full=Uncharacterized protein RC0550; SW:GN OrderedLocusNames=RC0550; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->838|Y550_RICCN|0.0|100.0|838/838| SEG 69->84|iskieellilssiite| SEG 104->119|klfndliinnidikli| SEG 284->304|lcnnfdlkllflllknplinc| SEG 359->373|iltltkeitekllpt| RP:PDB:NREP 1 RP:PDB:REP 7->67|2e3lA|8e-08|27.1|59/99| RP:SCP:NREP 1 RP:SCP:REP 556->741|1w36B3|3e-20|11.4|185/276|c.52.1.24| HM:SCP:REP 200->518|1w36C2|5e-11|17.6|312/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 554->723|1w36B3|2.4e-05|16.7|162/0|c.52.1.24|1/1|Restriction endonuclease-like| OP:NHOMO 112 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11111111111111111111111111111-111111111111111111111111111--111-1--111111111111--111111-11111111111111111111111111--1---1------------------------------------------------------------------------------------------------------------11111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 7.0 SQ:SECSTR ######HHHccccEEEEcccTTcccc##cTTTccHHHHHHHHHTcTTcEEEEccccccccccccccc################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################### DISOP:02AL 1-2, 505-507, 548-555| PSIPRED ccccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHEEEcccccEEEEHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHccccEEEccccHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccEEEEEcHHHHHccccEEEEEccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccHHHHHHHcccccHHHHcccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccEEEEEccccEEEEEEEEEEEEccccEEEEEEEcccccccHHHHHHccccccHHHHHHHHHcccccccccccccccHHHHHHHccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEccccccccHHHHcc //