[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03094.1
DDBJ      :             glycerol-3-phosphate cytidyltransferase (tagD)-like protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:100 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->61 2b7lB PDBj 2e-09 51.8 %
:RPS:PDB   4->77 1cozA PDBj 5e-07 30.1 %
:RPS:SCOP  4->77 1cozA  c.26.1.2 * 4e-07 30.1 %
:HMM:SCOP  3->77 1cozA_ c.26.1.2 * 4.4e-09 29.7 %
:RPS:PFM   4->71 PF01467 * CTP_transf_2 9e-04 28.6 %
:HMM:PFM   4->60 PF01467 * CTP_transf_2 2e-07 30.9 55/157  
:BLT:SWISS 4->62 HLDE_CAMJD 6e-10 44.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03094.1 GT:GENE AAL03094.1 GT:PRODUCT glycerol-3-phosphate cytidyltransferase (tagD)-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(548101..548403) GB:FROM 548101 GB:TO 548403 GB:DIRECTION - GB:PRODUCT glycerol-3-phosphate cytidyltransferase (tagD)-like protein GB:PROTEIN_ID AAL03094.1 GB:DB_XREF GI:15619636 LENGTH 100 SQ:AASEQ MIYLHYGHIEFLRKTKKHGKYLIVALEPDETIIKYKKRQPIHNQLQRAKILSSFTFVDKVLILPKLQDFNDYARLVQNICPSVIAVTKHDPQLINKFKQN GT:EXON 1|1-100:0| BL:SWS:NREP 1 BL:SWS:REP 4->62|HLDE_CAMJD|6e-10|44.1|59/461| BL:PDB:NREP 1 BL:PDB:REP 4->61|2b7lB|2e-09|51.8|56/113| RP:PDB:NREP 1 RP:PDB:REP 4->77|1cozA|5e-07|30.1|73/126| RP:PFM:NREP 1 RP:PFM:REP 4->71|PF01467|9e-04|28.6|63/145|CTP_transf_2| HM:PFM:NREP 1 HM:PFM:REP 4->60|PF01467|2e-07|30.9|55/157|CTP_transf_2| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF01467|IPR004820| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01467|IPR004820| RP:SCP:NREP 1 RP:SCP:REP 4->77|1cozA|4e-07|30.1|73/126|c.26.1.2| HM:SCP:REP 3->77|1cozA_|4.4e-09|29.7|74/126|c.26.1.2|1/1|Nucleotidylyl transferase| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN ---------------------------------------------------------11-------11 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-11-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 86.0 SQ:SECSTR cccccHHHHHHHHHHHTTccEEEEEEEcHHHHHHHTcccccccHHHHHHHHTTcTTccEEEEEcccTTHHHHHHHTTTccccEEEE############## DISOP:02AL 96-100| PSIPRED cEEEcHHHHHHHHHHHHcccEEEEEEccHHHHHHcccccccccHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHcccEEEEcccccccccccccc //