[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03106.1
DDBJ      :             probable RND efflux transporter-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  509/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
b.163.1d.225.1d.58.44
:169 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->165 2v50E PDBj 1e-10 25.6 %
:RPS:PDB   1->169 2dhhA PDBj 2e-34 24.6 %
:RPS:SCOP  4->98 1zruA3  b.163.1.2 * 5e-15 11.1 %
:RPS:SCOP  75->169 1iwgA2  d.58.44.1 * 2e-11 13.8 %
:HMM:SCOP  30->114 1iwgA6 d.225.1.1 * 7.8e-13 22.4 %
:RPS:PFM   4->169 PF00873 * ACR_tran 5e-25 28.5 %
:HMM:PFM   3->168 PF00873 * ACR_tran 3.2e-41 32.7 165/1021  
:BLT:SWISS 4->167 MDTC_YERPY 2e-25 35.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03106.1 GT:GENE AAL03106.1 GT:PRODUCT probable RND efflux transporter-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(559429..559938) GB:FROM 559429 GB:TO 559938 GB:DIRECTION - GB:PRODUCT probable RND efflux transporter-like protein GB:PROTEIN_ID AAL03106.1 GB:DB_XREF GI:15619649 LENGTH 169 SQ:AASEQ MDYYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANVNLPTGALYGTDIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAAWYRDKPGVILAIQKQPDTTNTIEIVDSIKEVLPLLRRQIPEGININIMF GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 4->167|MDTC_YERPY|2e-25|35.0|163/1024| BL:PDB:NREP 1 BL:PDB:REP 4->165|2v50E|1e-10|25.6|160/1012| RP:PDB:NREP 1 RP:PDB:REP 1->169|2dhhA|2e-34|24.6|167/1022| RP:PFM:NREP 1 RP:PFM:REP 4->169|PF00873|5e-25|28.5|165/1014|ACR_tran| HM:PFM:NREP 1 HM:PFM:REP 3->168|PF00873|3.2e-41|32.7|165/1021|ACR_tran| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00873|IPR001036| GO:PFM GO:0006810|"GO:transport"|PF00873|IPR001036| GO:PFM GO:0016020|"GO:membrane"|PF00873|IPR001036| RP:SCP:NREP 2 RP:SCP:REP 4->98|1zruA3|5e-15|11.1|90/129|b.163.1.2| RP:SCP:REP 75->169|1iwgA2|2e-11|13.8|94/104|d.58.44.1| HM:SCP:REP 30->114|1iwgA6|7.8e-13|22.4|85/88|d.225.1.1|1/1|Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains| OP:NHOMO 1577 OP:NHOMOORG 515 OP:PATTERN -------------------------------------------------------------------- 45C---------------------------------------------------------------------------------1-315654-611---125-4-63412--------------1111-1-11221----------2233432112212112134242461-1-----1-----1-----11------------------------------1--------2--------------------------------------------------------------------------------------------41-2-------1-1-122---------1--31--22211--1-----2-4317111-----458667564665422232333225-55746867455-5555334223339711-1-12122-112222222224343623---------1--1122-221112211-1----113575554566644222155894444345377898-246325413766355256363333-------33216431--1-12254222-23-123434324265241----11111-11-111111-1--144344342223323122233653335358465--13216------44322443333333433-3443333334333333333445322232222222222222222332-2233--333333332333--1134333343332421---111-1111-1114444435---736676757766865323311111111131443222223524457555554443333--1-3333221--1-111--------------------------------------164 --------------------------------------------------------------------------------------------------------------------------------------------------------------3----1-1-------1--------------4-----3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 169 STR:RPRED 100.0 SQ:SECSTR HHHHHHHTTHHHHHccccccEEEEccccccccEEEEcHHHHHTTTccHHHHHHHHTTTcccccccccccccccTccccccccccHHHHccEEEccTTTccEEHHHHEEEEccccccccEEEETTEEcccEEEEHccccccHHHHHHHHHHHHTTTcccccccEEEEccc PSIPRED cHHHHHHHHHHHHHHccccEEEEEEccccEEEEEEEcHHHHHHccccHHHHHHHHHHcccccccEEEEcccEEEEEEEccccccHHHHHHHEEEccccEEEEEEEEEEEEEccccccEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccEEEEcc //