[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03107.1
DDBJ      :             probable RND efflux transporter-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  223/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.58.44
:72 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->59 2rddA PDBj 7e-05 37.9 %
:RPS:PDB   2->60 2dhhA PDBj 4e-15 37.3 %
:RPS:SCOP  2->60 1iwgA1  d.58.44.1 * 8e-12 37.3 %
:HMM:SCOP  1->60 1iwgA1 d.58.44.1 * 3e-10 31.7 %
:RPS:PFM   2->59 PF00873 * ACR_tran 2e-06 34.5 %
:HMM:PFM   1->63 PF00873 * ACR_tran 3.5e-17 30.2 63/1021  
:BLT:SWISS 1->60 MDTC_SERP5 2e-15 55.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03107.1 GT:GENE AAL03107.1 GT:PRODUCT probable RND efflux transporter-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(560007..560225) GB:FROM 560007 GB:TO 560225 GB:DIRECTION - GB:PRODUCT probable RND efflux transporter-like protein GB:PROTEIN_ID AAL03107.1 GB:DB_XREF GI:15619650 LENGTH 72 SQ:AASEQ MPGADPTTMASSVALPLEKQCSTISDIDSMSSVNSNGTTQITLQFNLDRNIDAAAQDIQATTERLTYPALIL GT:EXON 1|1-72:0| BL:SWS:NREP 1 BL:SWS:REP 1->60|MDTC_SERP5|2e-15|55.0|60/1026| BL:PDB:NREP 1 BL:PDB:REP 2->59|2rddA|7e-05|37.9|58/1018| RP:PDB:NREP 1 RP:PDB:REP 2->60|2dhhA|4e-15|37.3|59/1022| RP:PFM:NREP 1 RP:PFM:REP 2->59|PF00873|2e-06|34.5|58/1014|ACR_tran| HM:PFM:NREP 1 HM:PFM:REP 1->63|PF00873|3.5e-17|30.2|63/1021|ACR_tran| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00873|IPR001036| GO:PFM GO:0006810|"GO:transport"|PF00873|IPR001036| GO:PFM GO:0016020|"GO:membrane"|PF00873|IPR001036| RP:SCP:NREP 1 RP:SCP:REP 2->60|1iwgA1|8e-12|37.3|59/97|d.58.44.1| HM:SCP:REP 1->60|1iwgA1|3e-10|31.7|60/0|d.58.44.1|1/1|Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains| OP:NHOMO 370 OP:NHOMOORG 225 OP:PATTERN -------------------------------------------------------------------- -14-------------------------------------------------------------------------------------------------------------------------1-----------------------------------------1--2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1--------323333--31111---1-111----22222323-2--1--2--------23-------------22222222-2131-----------------11-11---1-----------1222222122223----22112222221211132-1112--1--111-31-11----11---------1-11--------341111-1--1112-111111--1-------------------------22-------------------------------------------212111-2212222222-2222222212222222222111221112222222222222222121-1112--11111111-111---------------------------------------3---41----3221112122233-------------------------11-1--1111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------2------1--------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 81.9 SQ:SECSTR #ccccHHHHHTTTHHHHcTTcccccccccccEEETTccEEccEEccTTccHHHHHHHHHH############ PSIPRED cccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEEEEccccHHHHHHHHHHHHHHcccccccc //