[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03177.1
DDBJ      :             unknown
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.11
:103 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   31->99 3dsnD PDBj 2e-07 18.8 %
:RPS:SCOP  27->99 1kiuA1  b.1.11.1 * 2e-07 15.3 %
:HMM:SCOP  1->99 1p5vA1 b.1.11.1 * 1.4e-07 25.5 %
:RPS:PFM   25->80 PF00345 * Pili_assembly_N 4e-04 28.6 %
:HMM:PFM   2->99 PF00345 * Pili_assembly_N 1.4e-09 20.4 93/122  
:BLT:SWISS 1->58 DP2L_METMP 5e-04 38.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03177.1 GT:GENE AAL03177.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 623600..623911 GB:FROM 623600 GB:TO 623911 GB:DIRECTION + GB:PRODUCT unknown GB:PROTEIN_ID AAL03177.1 GB:DB_XREF GI:15619726 LENGTH 103 SQ:AASEQ MTVQNNDYAPKKFQLIRLKRTYKDGIEEYKETKDLVATPVTFTLHDGKIQLIRVALKNTQNYSTKAKYRIFIKELPRRVKLENSVTSTVDLVVQHSIPITISG GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 1->58|DP2L_METMP|5e-04|38.6|57/100| RP:PDB:NREP 1 RP:PDB:REP 31->99|3dsnD|2e-07|18.8|64/190| RP:PFM:NREP 1 RP:PFM:REP 25->80|PF00345|4e-04|28.6|56/122|Pili_assembly_N| HM:PFM:NREP 1 HM:PFM:REP 2->99|PF00345|1.4e-09|20.4|93/122|Pili_assembly_N| GO:PFM:NREP 3 GO:PFM GO:0005515|"GO:protein binding"|PF00345|IPR016147| GO:PFM GO:0007047|"GO:cellular cell wall organization"|PF00345|IPR016147| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00345|IPR016147| RP:SCP:NREP 1 RP:SCP:REP 27->99|1kiuA1|2e-07|15.3|72/121|b.1.11.1| HM:SCP:REP 1->99|1p5vA1|1.4e-07|25.5|94/0|b.1.11.1|1/1|PapD-like| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 89.3 SQ:SECSTR EEEEccccccEEEEEEEEEE######TTccEcccEEEEccEEEEcTTcEEEEEEEccccccccccEEEEEEEEEEccc#cccccccccccccEEEEEEE#### DISOP:02AL 80-83| PSIPRED cEEEEcccccEEEEEEEEEEEEccccccccccccEEEcccEEEEccccEEEEEEEEccccccccccEEEEEEEEcccccccccccccEEEEEEEEccEEEEEc //