[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03198.1
DDBJ      :             unknown
Swiss-Prot:Y660_RICCN   RecName: Full=Uncharacterized protein RC0660;

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   109->194 PF06835 * DUF1239 6e-06 32.6 %
:HMM:PFM   52->194 PF06835 * DUF1239 2.2e-11 14.7 143/176  
:HMM:PFM   8->36 PF10658 * DUF2484 0.00028 31.0 29/77  
:BLT:SWISS 1->198 Y660_RICCN e-111 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03198.1 GT:GENE AAL03198.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(640823..641419) GB:FROM 640823 GB:TO 641419 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL03198.1 GB:DB_XREF GI:15619748 LENGTH 198 SQ:AASEQ MPSSYKLRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVTKKSLKDNKNFDLKYNIILKDSIFEGVNKNLNAYKIKTERAIKESNNKYKLDIINAIYNVNQDQTLIINAKEGFLDEESSILDLKNDVKLFFDEIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFNTKDENNIIIFKGNVSTIIDLSD GT:EXON 1|1-198:0| SW:ID Y660_RICCN SW:DE RecName: Full=Uncharacterized protein RC0660; SW:GN OrderedLocusNames=RC0660; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->198|Y660_RICCN|e-111|100.0|198/198| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 13->35| RP:PFM:NREP 1 RP:PFM:REP 109->194|PF06835|6e-06|32.6|86/170|DUF1239| HM:PFM:NREP 2 HM:PFM:REP 52->194|PF06835|2.2e-11|14.7|143/176|DUF1239| HM:PFM:REP 8->36|PF10658|0.00028|31.0|29/77|DUF2484| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccccEEHHcccccccccEEEEEEEEccEEEEEcccccEEEEEEEEHEEccccEEEEEEEEEEEcccccccEEEEEcccEEEcccEEEEEEccEEEEEEEEEEEcccEEEEEEcccEEcccccEEEcccccEEEEEEEEcccccEEEEEccEEEEEEEcc //