[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03215.1
DDBJ      :             unknown
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:102 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  4->102 2fe1A1  c.120.1.1 * 2e-05 18.2 %
:HMM:SCOP  1->102 2fe1A1 c.120.1.1 * 4.7e-08 27.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03215.1 GT:GENE AAL03215.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 656167..656475 GB:FROM 656167 GB:TO 656475 GB:DIRECTION + GB:PRODUCT unknown GB:PROTEIN_ID AAL03215.1 GB:DB_XREF GI:15619766 LENGTH 102 SQ:AASEQ MVSFVLDSSIALSWLMPDEVASLDILDKTITEGAIVPAIWGLEIGNVLLCAERAKRLTANQRHQAIYTLKDLYIKIDQITLEHIWFETMDLAVQYGLTLYDA GT:EXON 1|1-102:0| RP:SCP:NREP 1 RP:SCP:REP 4->102|2fe1A1|2e-05|18.2|99/130|c.120.1.1| HM:SCP:REP 1->102|2fe1A1|4.7e-08|27.3|99/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --1----------------------------------------------------------------------------------------------------------------------------------------1---------------11---------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11-1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 101-102| PSIPRED cHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccc //