[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03241.1
DDBJ      :             alkaline phosphatase synthesis sensor protein (phoR)-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
a.30.2d.131.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->93 3dgeA PDBj 6e-10 28.0 %
:RPS:PDB   1->104 2de0X PDBj 7e-14 18.8 %
:RPS:SCOP  1->68 2c2aA1  a.30.2.1 * 1e-10 38.2 %
:RPS:SCOP  48->89 1vpkA1  d.131.1.1 * 6e-04 16.7 %
:HMM:SCOP  1->71 2c2aA1 a.30.2.1 * 5.4e-13 38.0 %
:RPS:PFM   9->68 PF00512 * HisKA 1e-05 35.0 %
:HMM:PFM   1->67 PF00512 * HisKA 9.1e-19 34.8 66/68  
:HMM:PFM   102->129 PF10582 * Connexin_CCC 0.00011 35.7 28/67  
:BLT:SWISS 1->110 YCF26_PORPU 7e-11 33.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03241.1 GT:GENE AAL03241.1 GT:PRODUCT alkaline phosphatase synthesis sensor protein (phoR)-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 677297..677695 GB:FROM 677297 GB:TO 677695 GB:DIRECTION + GB:PRODUCT alkaline phosphatase synthesis sensor protein (phoR)-like protein GB:PROTEIN_ID AAL03241.1 GB:DB_XREF GI:15619795 LENGTH 132 SQ:AASEQ MKHEFLRNINHEINTPLTGIISLGETLWANYDKFNEDQRRNAVEIIAKSSIKLNSLINNILDFSKLSSLNYALNKKDINLSELLHERIKICKKLYLNGKILNFVSDIEKNIIIIFFSILTVILIILNTHSII GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 1->110|YCF26_PORPU|7e-11|33.6|107/656| TM:NTM 1 TM:REGION 107->129| SEG 111->126|iiiiffsiltviliil| BL:PDB:NREP 1 BL:PDB:REP 1->93|3dgeA|6e-10|28.0|93/237| RP:PDB:NREP 1 RP:PDB:REP 1->104|2de0X|7e-14|18.8|101/460| RP:PFM:NREP 1 RP:PFM:REP 9->68|PF00512|1e-05|35.0|60/69|HisKA| HM:PFM:NREP 2 HM:PFM:REP 1->67|PF00512|9.1e-19|34.8|66/68|HisKA| HM:PFM:REP 102->129|PF10582|0.00011|35.7|28/67|Connexin_CCC| GO:PFM:NREP 3 GO:PFM GO:0000155|"GO:two-component sensor activity"|PF00512|IPR003661| GO:PFM GO:0007165|"GO:signal transduction"|PF00512|IPR003661| GO:PFM GO:0016020|"GO:membrane"|PF00512|IPR003661| RP:SCP:NREP 2 RP:SCP:REP 1->68|2c2aA1|1e-10|38.2|68/89|a.30.2.1| RP:SCP:REP 48->89|1vpkA1|6e-04|16.7|42/120|d.131.1.1| HM:SCP:REP 1->71|2c2aA1|5.4e-13|38.0|71/0|a.30.2.1|1/1|Homodimeric domain of signal transducing histidine kinase| OP:NHOMO 132 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------1--------1-------1-1------------------2-21------------1-1111-------------------23-----------------------1111111111-11----111-11---------------------------------------------------------------------------------------------------------------2222232121--------1----11---11-2-1--------------------------------------------------------11------11-111-------1----------------------1----------------11111--1111-------------------------------------------------1------------------------------12-----1---2--1---------------1----------------------2---------112--11------------------------11---------------------------------------------------------------------------------------------------------1--------------------------------------------------------111------1-1------------------1-11--11------------------------------------11-1-1------- ---------------1-11------------------111--11----21--1-11------------------------------------------------------------------------------------------------------------------------11-----------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 82.6 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHEEHHHHHHHHTccHHHHHHHGHHHHHHHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHccccGGGccEEEHHHHH####################### DISOP:02AL 33-34| PSIPRED cccHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEccHHHHHHHHHHHHHHHHHHHccEEEEEEEccccEEEEcccHHHHHHHHHHHHcc //