[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03242.1
DDBJ      :             alkaline phosphatase synthesis sensor protein (phoR)-like protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  283/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:82 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   13->81 3dgeA PDBj 6e-10 40.6 %
:RPS:PDB   1->82 3d2rB PDBj 5e-15 18.3 %
:RPS:SCOP  11->82 1bxdA  d.122.1.3 * 2e-13 26.4 %
:HMM:SCOP  13->82 1gkzA2 d.122.1.4 * 8.3e-18 42.9 %
:RPS:PFM   13->82 PF02518 * HATPase_c 5e-11 41.4 %
:HMM:PFM   11->82 PF02518 * HATPase_c 5.9e-20 38.9 72/111  
:BLT:SWISS 14->82 PHYA_ANASP 5e-12 42.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03242.1 GT:GENE AAL03242.1 GT:PRODUCT alkaline phosphatase synthesis sensor protein (phoR)-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 677738..677986 GB:FROM 677738 GB:TO 677986 GB:DIRECTION + GB:PRODUCT alkaline phosphatase synthesis sensor protein (phoR)-like protein GB:PROTEIN_ID AAL03242.1 GB:DB_XREF GI:15619796 LENGTH 82 SQ:AASEQ MIYTCKKIISCFISIRDDGIGVLKEELQSIFGVFVVSSKTRTVGGRGVGLALCKKVIELHAGKIWAENDKQGKTTFIFTMPL GT:EXON 1|1-82:0| BL:SWS:NREP 1 BL:SWS:REP 14->82|PHYA_ANASP|5e-12|42.0|69/765| BL:PDB:NREP 1 BL:PDB:REP 13->81|3dgeA|6e-10|40.6|69/237| RP:PDB:NREP 1 RP:PDB:REP 1->82|3d2rB|5e-15|18.3|82/362| RP:PFM:NREP 1 RP:PFM:REP 13->82|PF02518|5e-11|41.4|70/112|HATPase_c| HM:PFM:NREP 1 HM:PFM:REP 11->82|PF02518|5.9e-20|38.9|72/111|HATPase_c| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 1 RP:SCP:REP 11->82|1bxdA|2e-13|26.4|72/161|d.122.1.3| HM:SCP:REP 13->82|1gkzA2|8.3e-18|42.9|70/193|d.122.1.4|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 519 OP:NHOMOORG 300 OP:PATTERN -------------------------------1-----122223-3-1-37424--------------- 117------------------1--11-----111111----111-1------------------1---11------------------1111---------1---133-1------------------------2-244772123-A3353411-11------21126461------------53-----1-2-222223332333333-111--3331111142333333121111111111111111121211-1--1-111------1111-1111---11-1111-----------111-111111111111---111111-22-------1-31111---11-------1-121212--2-111-----11----------1-12--1---1-----------------------------1-----11--1-------------------------I------------27-111-11--1111------1--------------11111--121111-------------------1-------3--1------------2--21-1-1-3---111--18-5-11-1-----3-1-----------------------------------11--11111-----11--21-1---1-----------111-1---------------------------------11111----------------1---------11111111-111---------------2-1---------------------------------1-----------1-1-22-1------------1------------------5-11--22-------------------------------------2----------- --------------------------------------------------------------------------------------------------------1--1-----------------------------------------------------------------------------5------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 100.0 SQ:SECSTR EEEEEEcccEEEEEEEEccccccGGGTTGGGcTTccccccccccccccHHHHHHHHHHHTTcEEEEEEETTTEEEEEEEEEc PSIPRED cEEEEEEccEEEEEEEEccccccHHHHHHHHHHHEEcccccccccccHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEEc //