[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03255.1
DDBJ      :             unknown
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  234/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->175 PF01810 * LysE 8e-10 26.6 %
:HMM:PFM   18->202 PF01810 * LysE 8e-36 28.8 184/192  
:BLT:SWISS 6->179 YISU_BACSU 2e-49 51.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03255.1 GT:GENE AAL03255.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(688449..689090) GB:FROM 688449 GB:TO 689090 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL03255.1 GB:DB_XREF GI:15619809 LENGTH 213 SQ:AASEQ MNNDILSAFLHGIVLALGLIVPLGVQNIFIFNQGATQPKFSKALPSIIAASICDTMLICMAVLGISLLILEISWLKLSIFIVGFIFLIYMGYNTWNQPPIDLTMNSGAFSAQKQILFAISVSILNPHAIMDTIIVIGISALKYSGIAKIIFTLTCILISWIWFFSLAVAGYNIRKLNKSSTILTIINKIAAIIIWAVAFYIGVQILYEIGFIN GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 6->179|YISU_BACSU|2e-49|51.1|174/220| TM:NTM 6 TM:REGION 8->30| TM:REGION 44->66| TM:REGION 70->91| TM:REGION 114->136| TM:REGION 149->171| TM:REGION 184->206| SEG 182->201|iltiinkiaaiiiwavafyi| RP:PFM:NREP 1 RP:PFM:REP 17->175|PF01810|8e-10|26.6|158/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 18->202|PF01810|8e-36|28.8|184/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 240 OP:NHOMOORG 235 OP:PATTERN ----------------------------1--------------------------------------- --------------------------------------1----------------1-1-------------------------------------------------------------------------------------------------------------------------------------1--11111111111111111--111111-11---------1111112111111111121-11-----------11----1-------------------------------------------------------1-------------11---------1--------------------------------------------------------1--------------11-1-1--11--------------11----------------------------1-2211111-11----------1-----1111111111111111111-1111---1----------1-------------------------------1------11------------------------------------------------1---11--111111--111111111111-------------11111111111111111-11111111111111111111111-2111-11-1111111111111111111--111-11111111---------1111----11111-1---------1111111---1-------------------1----1-1----11111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 96-113| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //