[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03279.1
DDBJ      :             histon and other protein acetyltransferase-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->134 1qsmD PDBj 3e-07 36.6 %
:RPS:PDB   4->147 3ec4A PDBj 3e-13 11.2 %
:RPS:SCOP  2->146 1s3zA  d.108.1.1 * 6e-13 11.9 %
:HMM:SCOP  1->149 1y9wA1 d.108.1.1 * 6.8e-19 34.6 %
:RPS:PFM   54->134 PF00583 * Acetyltransf_1 9e-05 33.8 %
:HMM:PFM   53->134 PF00583 * Acetyltransf_1 1.6e-12 32.5 80/83  
:BLT:SWISS 48->134 HPA2_YEAST 9e-07 36.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03279.1 GT:GENE AAL03279.1 GT:PRODUCT histon and other protein acetyltransferase-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 709451..709900 GB:FROM 709451 GB:TO 709900 GB:DIRECTION + GB:PRODUCT histon and other protein acetyltransferase-like protein GB:PROTEIN_ID AAL03279.1 GB:DB_XREF GI:15619835 LENGTH 149 SQ:AASEQ MSSVNISLATPDNITNILPLMAQLGYPSSSEELIARFKNFINREGYDVALASLDNKIVGFIAWSKSLLFASDKTKIHIEALVIDENYRGKQIGKKLMEYLEEIAKKYSLVIVDLTSGYRCAKDSTHIFYEVLGYHNSGEMAKLYLRKEL GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 48->134|HPA2_YEAST|9e-07|36.6|82/156| BL:PDB:NREP 1 BL:PDB:REP 48->134|1qsmD|3e-07|36.6|82/152| RP:PDB:NREP 1 RP:PDB:REP 4->147|3ec4A|3e-13|11.2|134/218| RP:PFM:NREP 1 RP:PFM:REP 54->134|PF00583|9e-05|33.8|74/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 53->134|PF00583|1.6e-12|32.5|80/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 2->146|1s3zA|6e-13|11.9|143/147|d.108.1.1| HM:SCP:REP 1->149|1y9wA1|6.8e-19|34.6|133/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1-----------1-11-11---11------------------------------1111-----11------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-1-11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 100.0 SQ:SECSTR EEcEccccccccccTTcEEccGGHHHHHHHHHcccccccTTGGGcccEEEEEETTEEEEEEEcccEcccHHcTTEEEEEEEEEcGGGTTccHHHHHHHHHHHHHHTTcEEEEEEETTcHHHHHHHHHHHHHTTcEEEEEEEEEEEEccc DISOP:02AL 148-150| PSIPRED ccccEEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccEEEEEEEccEEEEEEEEEEEEcccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHcccEEEEEccHHHHHHcc //