[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03312.1
DDBJ      :             RP534-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->106 PF07270 * DUF1438 0.00011 26.0 77/151  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03312.1 GT:GENE AAL03312.1 GT:PRODUCT RP534-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(733147..733629) GB:FROM 733147 GB:TO 733629 GB:DIRECTION - GB:PRODUCT RP534-like protein GB:PROTEIN_ID AAL03312.1 GB:DB_XREF GI:15619871 LENGTH 160 SQ:AASEQ MDFKDAQKYSNYLHIKGYCQTREHLNNHDLGKEADKIFDHQKFLLNVYEVYDNKNLHKTFGTKLLEMFIQSKENNTSKWQEGVIENHDDKAKMLLSFCKTGALNEKELNEKLKEYVIIAATSRNNTLKADTNSLNALLYTLNDTAASSKIKDSFIVRYLE GT:EXON 1|1-160:0| SEG 103->114|lnekelneklke| HM:PFM:NREP 1 HM:PFM:REP 29->106|PF07270|0.00011|26.0|77/151|DUF1438| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111-1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 4-6, 75-76| PSIPRED cccHHHHHHHcEEHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHEEEEEEEccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccc //