[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03377.1
DDBJ      :             3-hydroxyacyl-CoA dehydrogenase (FadB)-like protein
Swiss-Prot:Y839_RICCN   RecName: Full=Putative uncharacterized protein RC0839;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->63 PF03421 * YopJ 0.0003 18.8 48/178  
:BLT:SWISS 1->70 Y839_RICCN 3e-38 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03377.1 GT:GENE AAL03377.1 GT:PRODUCT 3-hydroxyacyl-CoA dehydrogenase (FadB)-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(792614..792826) GB:FROM 792614 GB:TO 792826 GB:DIRECTION - GB:PRODUCT 3-hydroxyacyl-CoA dehydrogenase (FadB)-like protein GB:PROTEIN_ID AAL03377.1 GB:DB_XREF GI:15619941 LENGTH 70 SQ:AASEQ MKLGYSWKYGPFELLTIAAKNGWNSVIKNADLMHIPLPQYLANKEYQKIDKQKFNSHKDILQESQISIRE GT:EXON 1|1-70:0| SW:ID Y839_RICCN SW:DE RecName: Full=Putative uncharacterized protein RC0839; SW:GN OrderedLocusNames=RC0839; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->70|Y839_RICCN|3e-38|100.0|70/70| HM:PFM:NREP 1 HM:PFM:REP 16->63|PF03421|0.0003|18.8|48/178|YopJ| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11--1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 68-70| PSIPRED cccccccccccEEEEEEEEcccHHHHHccccEEEEccHHHHccHHHHHHHHHHcccHHHHHHcccccccc //