[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03396.1
DDBJ      :             unknown
Swiss-Prot:MRAZ_RICCN   RecName: Full=Protein mraZ;

Homologs  Archaea  0/68 : Bacteria  195/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.129.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->137 1n0fB PDBj 2e-11 27.3 %
:RPS:SCOP  2->138 1n0eA  b.129.1.2 * 5e-34 25.0 %
:HMM:SCOP  1->140 1n0eA_ b.129.1.2 * 5.5e-32 33.3 %
:RPS:PFM   79->128 PF02381 * MraZ 9e-05 26.0 %
:HMM:PFM   12->31 PF02381 * MraZ 5.6e-05 35.0 20/72  
:HMM:PFM   79->146 PF02381 * MraZ 6.1e-19 26.5 68/72  
:BLT:SWISS 1->149 MRAZ_RICCN 2e-84 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03396.1 GT:GENE AAL03396.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(809497..809946) GB:FROM 809497 GB:TO 809946 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL03396.1 GB:DB_XREF GI:15619961 LENGTH 149 SQ:AASEQ MNVFLSKYVNGVDKKSRVSVPANYRAVLGKELFNGVIAYPSIRNNCIEVCGISHIEKLRQMIETLDPYSEERDAFETMIFGEAVQLSFDGEGRVILPQSLMKHAGIEEQACFVGKGVIFEIWQPQNFEKYLNAAQKIAHEKRLTLRNAH GT:EXON 1|1-149:0| SW:ID MRAZ_RICCN SW:DE RecName: Full=Protein mraZ; SW:GN Name=mraZ; OrderedLocusNames=RC0858; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->149|MRAZ_RICCN|2e-84|100.0|149/149| BL:PDB:NREP 1 BL:PDB:REP 12->137|1n0fB|2e-11|27.3|121/139| RP:PFM:NREP 1 RP:PFM:REP 79->128|PF02381|9e-05|26.0|50/69|MraZ| HM:PFM:NREP 2 HM:PFM:REP 12->31|PF02381|5.6e-05|35.0|20/72|MraZ| HM:PFM:REP 79->146|PF02381|6.1e-19|26.5|68/72|MraZ| RP:SCP:NREP 1 RP:SCP:REP 2->138|1n0eA|5e-34|25.0|132/141|b.129.1.2| HM:SCP:REP 1->140|1n0eA_|5.5e-32|33.3|132/0|b.129.1.2|1/1|AbrB/MazE/MraZ-like| OP:NHOMO 196 OP:NHOMOORG 195 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------1-------------------------------------------------1-1---------------------------11111----1-------------------------------------------1-1-----------------1-----------1---------11----------------------111111-------111-1111-----------------------------------------------111-1111111111-1--------1-1111--111--1-111-111-------1111-----11-------------------------------1-1112-111111111111-11-1----1111111111111111111------------1111111111111----1-------------------------------------------------1--------1-------------111--------------1---------------1-----------------------------111-11-1---111111111111-11-11----1-1---------111-------------------------------------111----------------1------11-111111111111---1111111111--1-11111---111-111---------------------------------------1--------------11-------------------------------------------------1--1------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 81.2 SQ:SECSTR ###########ccTTcEEEcccHHHH#####HcccEEccccccccccEEccHHHHHHHHHHHHTcccccHHHHHHHHHHHTTcccEEccTTcEEEccHHHHHHTTccccEEEEEccccEEEEEHHHHHHHHHccccH############ DISOP:02AL 64-66, 141-142, 146-149| PSIPRED cccccccccccccccccEEccHHHHHHHHccccccEEEEEcccccEEEEccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEcccccEEccHHHHHHHccccEEEEEEcccEEEEccHHHHHHHHHHHHHHHHHHHHHHcccc //