[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03471.1
DDBJ      :             unknown
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  453/915 : Eukaryota  1/199 : Viruses  1/175   --->[See Alignment]
c.1.28d.350.1
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   23->123 3c8fA PDBj 1e-08 19.2 %
:RPS:SCOP  44->123 2h7aA1  d.350.1.1 * 3e-09 12.5 %
:HMM:SCOP  35->122 1tv8A_ c.1.28.3 * 1.7e-09 31.3 %
:RPS:PFM   45->122 PF04055 * Radical_SAM 9e-09 45.2 %
:HMM:PFM   41->127 PF04055 * Radical_SAM 4.4e-13 33.3 81/166  
:BLT:SWISS 20->224 Y401_BUCAP 2e-21 35.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03471.1 GT:GENE AAL03471.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(875124..875801) GB:FROM 875124 GB:TO 875801 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL03471.1 GB:DB_XREF GI:15620043 LENGTH 225 SQ:AASEQ MFGQNPKRSILNGDGTQLEVQSIFKTIQGEGIFVGCPAIFIRLGGCNLACNFCDTEFEDFDLVDIDKILNKVESLALNSKNEKSINLVVITGGEPMRQPIELLCQKLLDRDVKVQIETNGTLYRSLPKEVSIICSPKVGKTGYSKIREDLLPKISAVKFIVAKNILEYSLIPEVGQTSYNIPVFIQPMDQNNQRLNGENNELAVKLALESGARLSLQTHKFLNIP GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 20->224|Y401_BUCAP|2e-21|35.4|192/219| RP:PDB:NREP 1 RP:PDB:REP 23->123|3c8fA|1e-08|19.2|99/245| RP:PFM:NREP 1 RP:PFM:REP 45->122|PF04055|9e-09|45.2|73/164|Radical_SAM| HM:PFM:NREP 1 HM:PFM:REP 41->127|PF04055|4.4e-13|33.3|81/166|Radical_SAM| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 44->123|2h7aA1|3e-09|12.5|80/109|d.350.1.1| HM:SCP:REP 35->122|1tv8A_|1.7e-09|31.3|83/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 496 OP:NHOMOORG 491 OP:PATTERN ---1-111111111-1--1111111111--1-1-111------11111--111---------11---- 111--------------------------------------111------------------1--------------------111111111-111---111111111-1---------------11111111111--------1--11-111--111111--11-1---111111--1111--------1-------------1---1-1-----------111-------11--------------11-------------------------------------11----------------------------------1--11--------------1-----1---1-----11----1----1----11111------1-1-----11-111-111111111------1--121111111111111-1--11----------11111111---111-1------------1111111111111-----1-1211111-111111111111112111111111111111-1--11--1111111111111-11111111111-1111-1-----1----1-1-1-1-1-111111111---1------1-1111111-11-1111111112111112111111111111111111--1--11-----11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--111111111111111-1111111111-1--11111111111-1111111111----1111---------11111111111111111111111111111111-----------------------------------------------------111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------- STR:NPRED 167 STR:RPRED 74.2 SQ:SECSTR ###################ccEEEEEEEEEEcTTcccEEEEEEcccccccTTcccGTTccEEEcHHHHHHHHGGGHHHHHHTcTTcEEEEEEccGGGGHHHHHHHHHHTTTccEEEEEcccccHHHHHHEEccccHHHHHHHHccccHHHHHHHHHHHHTTccEEEEEEEccTTTccHHHHHHHHH####################################### DISOP:02AL 1-12| PSIPRED ccccccccccccccccEEEEEEEEEcccccccccccEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEEccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccHHccHHHHHHHHHHHHccccEEEEEEEEEEccc //