[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03598.1
DDBJ      :             lipopolysaccharide biosynthesis protein-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->98 PF01755 * Glyco_transf_25 5e-08 37.5 %
:HMM:PFM   1->100 PF01755 * Glyco_transf_25 1.6e-16 29.3 99/200  
:BLT:SWISS 5->87 G251A_XENLA 2e-06 35.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03598.1 GT:GENE AAL03598.1 GT:PRODUCT lipopolysaccharide biosynthesis protein-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 984554..984871 GB:FROM 984554 GB:TO 984871 GB:DIRECTION + GB:PRODUCT lipopolysaccharide biosynthesis protein-like protein GB:PROTEIN_ID AAL03598.1 GB:DB_XREF GI:15620180 LENGTH 105 SQ:AASEQ MVKDNIPYALIIEDDAILNDDFRNKFLTMLKHLPTDWDLIYLSLSHSKNKIFYNIYNNPYLKKIGHSGYFNTTTGYLIHLKAAQKLLEYSKNFTLEIDNVPSFYA GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 5->87|G251A_XENLA|2e-06|35.8|81/611| RP:PFM:NREP 1 RP:PFM:REP 2->98|PF01755|5e-08|37.5|96/192|Glyco_transf_25| HM:PFM:NREP 1 HM:PFM:REP 1->100|PF01755|1.6e-16|29.3|99/200|Glyco_transf_25| GO:PFM:NREP 1 GO:PFM GO:0009103|"GO:lipopolysaccharide biosynthetic process"|PF01755|IPR002654| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccEEEEEEccEEEcHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //