[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03636.1
DDBJ      :             (p)ppGpp 3-pyrophosphohydrolase-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.211.1d.22.1
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->79 1vj7B PDBj 8e-07 43.4 %
:RPS:PDB   36->95 3djbA PDBj 1e-04 15.1 %
:RPS:SCOP  34->96 1gl4A1  d.22.1.2 * 2e-12 14.3 %
:HMM:SCOP  17->95 1vj7A1 a.211.1.1 * 2.9e-14 40.3 %
:HMM:PFM   60->93 PF04684 * BAF1_ABF1 0.00032 32.4 34/496  
:BLT:SWISS 46->81 RSH_BRUSU 2e-08 61.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03636.1 GT:GENE AAL03636.1 GT:PRODUCT (p)ppGpp 3-pyrophosphohydrolase-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1025194..1025493 GB:FROM 1025194 GB:TO 1025493 GB:DIRECTION + GB:PRODUCT (p)ppGpp 3-pyrophosphohydrolase-like protein GB:PROTEIN_ID AAL03636.1 GB:DB_XREF GI:15620222 LENGTH 99 SQ:AASEQ MEDIKSWKEKFEICVYAKKLVDKLEYLNTKVKNPVDIEEVKTGIYYARKYHGSQMRQSGDPYYSHPIEAAIILAKFVADEAPKLFTSNMINAALLPLYY GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 46->81|RSH_BRUSU|2e-08|61.1|36/750| BL:PDB:NREP 1 BL:PDB:REP 27->79|1vj7B|8e-07|43.4|53/310| RP:PDB:NREP 1 RP:PDB:REP 36->95|3djbA|1e-04|15.1|53/180| HM:PFM:NREP 1 HM:PFM:REP 60->93|PF04684|0.00032|32.4|34/496|BAF1_ABF1| RP:SCP:NREP 1 RP:SCP:REP 34->96|1gl4A1|2e-12|14.3|56/233|d.22.1.2| HM:SCP:REP 17->95|1vj7A1|2.9e-14|40.3|72/192|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 87 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LO3-6634922-232----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 62.6 SQ:SECSTR ##########################HHHHHccHHHHHHHHHHHHHHHHHTTccccTTTHHHHHHHHHHHHHHTTTcccH#######HHHHHHTT#### DISOP:02AL 1-2| PSIPRED cccHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcc //