[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03637.1
DDBJ      :             (p)ppGpp 3-pyrophosphohydrolase-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.211.1
:57 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  4->38 1vj7A1  a.211.1.1 * 7e-05 34.3 %
:HMM:SCOP  4->47 1vj7A1 a.211.1.1 * 9.4e-06 38.6 %
:HMM:PFM   13->53 PF08673 * RsbU_N 0.00094 29.3 41/77  
:BLT:SWISS 6->38 RSH_BRUSU 1e-05 57.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03637.1 GT:GENE AAL03637.1 GT:PRODUCT (p)ppGpp 3-pyrophosphohydrolase-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1025465..1025638 GB:FROM 1025465 GB:TO 1025638 GB:DIRECTION + GB:PRODUCT (p)ppGpp 3-pyrophosphohydrolase-like protein GB:PROTEIN_ID AAL03637.1 GB:DB_XREF GI:15620223 LENGTH 57 SQ:AASEQ MLLYFHYTIEDTELTEKLIIEIFGKEIVKHVEGLTRIKPHGQISVEESLNLLIKQKR GT:EXON 1|1-57:0| BL:SWS:NREP 1 BL:SWS:REP 6->38|RSH_BRUSU|1e-05|57.6|33/750| HM:PFM:NREP 1 HM:PFM:REP 13->53|PF08673|0.00094|29.3|41/77|RsbU_N| RP:SCP:NREP 1 RP:SCP:REP 4->38|1vj7A1|7e-05|34.3|35/172|a.211.1.1| HM:SCP:REP 4->47|1vj7A1|9.4e-06|38.6|44/192|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 32 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------315413621-222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 56-57| PSIPRED cEEEEccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccc //