[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03638.1
DDBJ      :             proline/betaine transporter-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->54 PF02197 * RIIa 0.00049 50.0 12/38  
:HMM:PFM   2->44 PF10269 * Tmemb_185A 0.00097 18.6 43/240  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03638.1 GT:GENE AAL03638.1 GT:PRODUCT proline/betaine transporter-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1025860..1026036) GB:FROM 1025860 GB:TO 1026036 GB:DIRECTION - GB:PRODUCT proline/betaine transporter-like protein GB:PROTEIN_ID AAL03638.1 GB:DB_XREF GI:15620224 LENGTH 58 SQ:AASEQ MIYAVSRALMCIITSFGIIYLTKYWGQYGLFVVMVPLLIICMFGLNHFQKLEKETGYS GT:EXON 1|1-58:0| TM:NTM 2 TM:REGION 1->22| TM:REGION 27->49| HM:PFM:NREP 2 HM:PFM:REP 43->54|PF02197|0.00049|50.0|12/38|RIIa| HM:PFM:REP 2->44|PF10269|0.00097|18.6|43/240|Tmemb_185A| OP:NHOMO 15 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------33314----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 52-58| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //