[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03639.1
DDBJ      :             proline/betaine transporter-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->71 PF04093 * MreD 3e-05 35.9 39/160  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03639.1 GT:GENE AAL03639.1 GT:PRODUCT proline/betaine transporter-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1026162..1026395) GB:FROM 1026162 GB:TO 1026395 GB:DIRECTION - GB:PRODUCT proline/betaine transporter-like protein GB:PROTEIN_ID AAL03639.1 GB:DB_XREF GI:15620225 LENGTH 77 SQ:AASEQ MCLAHIFYYTYITCGEVLKNAFGYSAAQVIHHNFIILMFHLASMSLICFLSYKIYPLKILRVKLALLLYLFYLHHTF GT:EXON 1|1-77:0| TM:NTM 2 TM:REGION 28->50| TM:REGION 55->77| SEG 57->73|lkilrvklalllylfyl| HM:PFM:NREP 1 HM:PFM:REP 33->71|PF04093|3e-05|35.9|39/160|MreD| OP:NHOMO 8 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------23-12----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 77-78| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //