[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03640.1
DDBJ      :             proline/betaine transporter-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->75 PF09568 * RE_MjaI 0.00012 33.3 27/199  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03640.1 GT:GENE AAL03640.1 GT:PRODUCT proline/betaine transporter-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1026399..1026626) GB:FROM 1026399 GB:TO 1026626 GB:DIRECTION - GB:PRODUCT proline/betaine transporter-like protein GB:PROTEIN_ID AAL03640.1 GB:DB_XREF GI:15620226 LENGTH 75 SQ:AASEQ MTTQGFNWRLAVWIDAIIAVVRGYAKAHLRETPDFVDASARLLRKYEKANIDKKELKNDEIFYQKPKRRQLYIFS GT:EXON 1|1-75:0| TM:NTM 1 TM:REGION 5->27| HM:PFM:NREP 1 HM:PFM:REP 49->75|PF09568|0.00012|33.3|27/199|RE_MjaI| OP:NHOMO 9 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22-14----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 75-76| PSIPRED cccccccEEEHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHccccEEEEEEc //