[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03644.1
DDBJ      :             ABC transporter substrate binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  304/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   38->111 PF02470 * MCE 3e-12 41.9 %
:HMM:PFM   37->114 PF02470 * MCE 8.5e-25 39.7 78/81  
:BLT:SWISS 35->149 Y1085_HAEIN 2e-15 40.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03644.1 GT:GENE AAL03644.1 GT:PRODUCT ABC transporter substrate binding protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1028922..1029371) GB:FROM 1028922 GB:TO 1029371 GB:DIRECTION - GB:PRODUCT ABC transporter substrate binding protein GB:PROTEIN_ID AAL03644.1 GB:DB_XREF GI:15620230 LENGTH 149 SQ:AASEQ MQQNIIETIIGFVVLIIALLFLIFAYKTGSSITSSKGYQVTAHFQSAEGIAVGSDVMISGIKIGSVKQITLDPNSFDASVYLNINDDVKIPKDSKAQVVTSGLLGGKYISIVPGNDDENLAANEEIKYTQSAINIESLINKIVSSFGSK GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 35->149|Y1085_HAEIN|2e-15|40.7|113/167| TM:NTM 1 TM:REGION 5->27| SEG 9->25|iigfvvliiallflifa| RP:PFM:NREP 1 RP:PFM:REP 38->111|PF02470|3e-12|41.9|74/81|MCE| HM:PFM:NREP 1 HM:PFM:REP 37->114|PF02470|8.5e-25|39.7|78/81|MCE| OP:NHOMO 319 OP:NHOMOORG 305 OP:PATTERN -------------------------------------------------------------------- ---------------12-------12-----1-212--22---------------------------1-2----------------11--------------------------------------------------------------------------------------1-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-211-----------------------------------------1---------------11-1111111111111111111221121211111111111111111111111111111---1-111111111111111111111111111111111111111111111111111111111111111111111111-11-1-111111111---111111------22---------------------1-1-11--111-1-1-1------1--------------11111----------1--1111111111-111111111111111111-----1-1-----------------11111111-----1-----------------11111-111111111111111--1----------1-11111111111111111111111111111111111111-1111111111111111---------------------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 115-122, 147-149| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccccccccEEEccEEEEEEEEEEEcccccEEEEEEEEcccEEEcccEEEEEEEccccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHccccc //