[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03719.1
DDBJ      :             multidrug resistance protein-like protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  310/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:136 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  65->136 1pv6A  f.38.1.2 * 7e-05 15.3 %
:HMM:SCOP  14->136 1pw4A_ f.38.1.1 * 7.5e-24 35.2 %
:RPS:PFM   40->134 PF07690 * MFS_1 8e-09 35.8 %
:HMM:PFM   31->135 PF07690 * MFS_1 3.2e-19 33.7 104/353  
:HMM:PFM   7->44 PF11750 * DUF3307 0.00063 23.7 38/127  
:BLT:SWISS 22->136 QACA_STAAU 2e-20 45.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03719.1 GT:GENE AAL03719.1 GT:PRODUCT multidrug resistance protein-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1082690..1083100) GB:FROM 1082690 GB:TO 1083100 GB:DIRECTION - GB:PRODUCT multidrug resistance protein-like protein GB:PROTEIN_ID AAL03719.1 GB:DB_XREF GI:15620310 LENGTH 136 SQ:AASEQ MVPQFPQTEYIAKDNSSSISYKFRWHILIILSICLLLVSMDATVLYAVMPTIILDLKPSNLQQLWIINAYALVLSGLLITAGALGDRFGRKRLLLWRLLVFSIASMLVYVFDSSWGLVLCRALLGLGGSVMMPSTL GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 22->136|QACA_STAAU|2e-20|45.2|115/514| TM:NTM 3 TM:REGION 30->52| TM:REGION 64->86| TM:REGION 101->123| SEG 27->37|iliilsiclll| RP:PFM:NREP 1 RP:PFM:REP 40->134|PF07690|8e-09|35.8|95/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 31->135|PF07690|3.2e-19|33.7|104/353|MFS_1| HM:PFM:REP 7->44|PF11750|0.00063|23.7|38/127|DUF3307| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 65->136|1pv6A|7e-05|15.3|72/417|f.38.1.2| HM:SCP:REP 14->136|1pw4A_|7.5e-24|35.2|122/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 569 OP:NHOMOORG 323 OP:PATTERN ------1-1222112----------------------------1-------------------1---- ----E1213321-21-133-33--53333333544584-2132534-2242-1122-3--5511412798-----1---------------1-1-----1-----1-------------------------------11-----12-------------------------------------111-----1-111111111-111111------111----11-11111111-1------------------1-1-11-----11----1-1-2-1-------------------------------------------------2------------1------------------11-1---1---------------------212------------------2----------2--211----12-13--------------------------------------------1---11----------------111112333321121222322212114341-11--111-14112------1---1-3--111111-1---1------------------1----------------------------------------111----------------------------------------2111-3-2222222222-222222222222222222-23211233222211211121212222211111--211111111111----111----------2111--1--------111111111111-112113-5211112312------------------------23112111111-----------11------------------------------------------------1 ---------------------------------------------------------------------------------------------------1---1------------------------------------------------------------------------------------------2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-22| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcc //