[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03778.1
DDBJ      :             strees induced DNA-binding proteins (the dps family)-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:54 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->51 1ji5A PDBj 1e-06 35.3 %
:RPS:PDB   1->51 2chpC PDBj 3e-09 33.3 %
:RPS:SCOP  1->53 2fjcA1  a.25.1.1 * 3e-16 20.8 %
:HMM:SCOP  1->53 1ji4A_ a.25.1.1 * 1.5e-08 32.1 %
:HMM:PFM   1->51 PF00210 * Ferritin 2.3e-08 21.6 51/142  
:BLT:SWISS 1->51 DPS2_BACAN 1e-06 35.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03778.1 GT:GENE AAL03778.1 GT:PRODUCT strees induced DNA-binding proteins (the dps family)-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1147979..1148143) GB:FROM 1147979 GB:TO 1148143 GB:DIRECTION - GB:PRODUCT strees induced DNA-binding proteins (the dps family)-like protein GB:PROTEIN_ID AAL03778.1 GB:DB_XREF GI:15620374 LENGTH 54 SQ:AASEQ MLKSLTKDQDIIRDTLYKGLKVAQAEGDEGTADMIIGRIKVHEKNRWMLKSSIL GT:EXON 1|1-54:0| BL:SWS:NREP 1 BL:SWS:REP 1->51|DPS2_BACAN|1e-06|35.3|51/146| BL:PDB:NREP 1 BL:PDB:REP 1->51|1ji5A|1e-06|35.3|51/142| RP:PDB:NREP 1 RP:PDB:REP 1->51|2chpC|3e-09|33.3|51/145| HM:PFM:NREP 1 HM:PFM:REP 1->51|PF00210|2.3e-08|21.6|51/142|Ferritin| RP:SCP:NREP 1 RP:SCP:REP 1->53|2fjcA1|3e-16|20.8|53/151|a.25.1.1| HM:SCP:REP 1->53|1ji4A_|1.5e-08|32.1|53/144|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-11-11111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 98.1 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHH# PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHc //