[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03781.1
DDBJ      :             beta-lactamase-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.3.1
:100 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->72 1m6kA PDBj 2e-04 35.4 %
:RPS:PDB   20->77 1e3uA PDBj 6e-05 17.3 %
:RPS:SCOP  1->81 1e3uA  e.3.1.1 * 3e-12 18.9 %
:HMM:SCOP  24->98 1xa1A_ e.3.1.1 * 5e-06 25.4 %
:HMM:PFM   3->89 PF00905 * Transpeptidase 9.6e-13 22.6 84/304  
:BLT:SWISS 1->80 BLO18_PSEAE 2e-07 41.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03781.1 GT:GENE AAL03781.1 GT:PRODUCT beta-lactamase-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1149825..1150127) GB:FROM 1149825 GB:TO 1150127 GB:DIRECTION - GB:PRODUCT beta-lactamase-like protein GB:PROTEIN_ID AAL03781.1 GB:DB_XREF GI:15620377 LENGTH 100 SQ:AASEQ MPVSVQAQEMTKNILFIEDFVDCWKRYGKTGSGNKLSQDRTVKLKDRKIGWFIGWLQKNDRTVFFVHFIENNKNYDSYAGQRSKEAAKEKLKELINQELK GT:EXON 1|1-100:0| BL:SWS:NREP 1 BL:SWS:REP 1->80|BLO18_PSEAE|2e-07|41.3|75/275| SEG 84->94|keaakeklkel| BL:PDB:NREP 1 BL:PDB:REP 1->72|1m6kA|2e-04|35.4|65/249| RP:PDB:NREP 1 RP:PDB:REP 20->77|1e3uA|6e-05|17.3|52/243| HM:PFM:NREP 1 HM:PFM:REP 3->89|PF00905|9.6e-13|22.6|84/304|Transpeptidase| RP:SCP:NREP 1 RP:SCP:REP 1->81|1e3uA|3e-12|18.9|74/243|e.3.1.1| HM:SCP:REP 24->98|1xa1A_|5e-06|25.4|63/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| OP:NHOMO 14 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11---11-----------------------------------------------------------------------------------------------1---------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------1211-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 82.0 SQ:SECSTR ccccHHHHHHHHHHTEEEEEETTEEEEEEEEEcccccccccccccccEEEEEEEEEEETTEEEEEEEEEEEccGGGTTHHHH################## DISOP:02AL 74-81, 98-100| PSIPRED ccccHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccccccccccEEEEEEEEEcccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHccccc //