[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03782.1
DDBJ      :             beta-lactamase-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.3.1
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->89 1m6kA PDBj 5e-12 39.2 %
:RPS:PDB   6->88 1e3uA PDBj 2e-07 24.7 %
:RPS:SCOP  10->89 1e3uA  e.3.1.1 * 4e-19 25.6 %
:HMM:SCOP  9->89 1e3uA_ e.3.1.1 * 3.6e-07 24.4 %
:HMM:PFM   10->89 PF00905 * Transpeptidase 5.5e-20 22.5 80/304  
:BLT:SWISS 3->89 BLO18_PSEAE 5e-18 45.8 %
:PROS 16->26|PS00337|BETA_LACTAMASE_D

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03782.1 GT:GENE AAL03782.1 GT:PRODUCT beta-lactamase-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1150266..1150538) GB:FROM 1150266 GB:TO 1150538 GB:DIRECTION - GB:PRODUCT beta-lactamase-like protein GB:PROTEIN_ID AAL03782.1 GB:DB_XREF GI:15620378 LENGTH 90 SQ:AASEQ MKIIKQEGNCESRYAPCSTFKIAISLMGYDDGFLIDETHPKLPVKEGYADYLEVWKQSQTPKDWMKNSCVWYSQIITKELGMEKFRDYVT GT:EXON 1|1-90:0| BL:SWS:NREP 1 BL:SWS:REP 3->89|BLO18_PSEAE|5e-18|45.8|83/275| PROS 16->26|PS00337|BETA_LACTAMASE_D|PDOC00134| BL:PDB:NREP 1 BL:PDB:REP 7->89|1m6kA|5e-12|39.2|79/249| RP:PDB:NREP 1 RP:PDB:REP 6->88|1e3uA|2e-07|24.7|81/243| HM:PFM:NREP 1 HM:PFM:REP 10->89|PF00905|5.5e-20|22.5|80/304|Transpeptidase| RP:SCP:NREP 1 RP:SCP:REP 10->89|1e3uA|4e-19|25.6|78/243|e.3.1.1| HM:SCP:REP 9->89|1e3uA_|3.6e-07|24.4|78/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| OP:NHOMO 36 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111---------1---------------------------1---------------11-11---11-----------------1111-1--------1111-11--------111-----1---------------------------1------------1---------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------1211-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 98.9 SQ:SECSTR ccccccHHHHTcEEccGGGGHHHHHHHHHHHTccccTTcccEEcccccccccGGGcccEEHHHHHHTTcHHHHHHHHHHHcHHHHHHHH# DISOP:02AL 90-91| PSIPRED cEEEEEHHHHcccccccHHHHHHHHHHHHHcccccccccEEEEccccccccHHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHHHHcc //