[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03816.1
DDBJ      :             DNA repair protein (RadC)-like protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  607/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->114 2qlcE PDBj 2e-14 34.4 %
:RPS:PFM   19->116 PF04002 * DUF2466 5e-23 45.9 %
:HMM:PFM   13->114 PF04002 * DUF2466 2.6e-35 44.1 102/123  
:BLT:SWISS 1->112 RADC_AGRT5 7e-31 52.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03816.1 GT:GENE AAL03816.1 GT:PRODUCT DNA repair protein (RadC)-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1186713..1187081 GB:FROM 1186713 GB:TO 1187081 GB:DIRECTION + GB:PRODUCT DNA repair protein (RadC)-like protein GB:PROTEIN_ID AAL03816.1 GB:DB_XREF GI:15620416 LENGTH 122 SQ:AASEQ MKQKIINKNINASWSSWIDYLKVNMGNMRLEQFRILFLNKKNILIADEVLSQGTIDQAAVYPREIIKRALFNEASSLILVHHHPSGSPEPSKANIHMTNKIVEKCQTINIIVLNLICSYEYK GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 1->112|RADC_AGRT5|7e-31|52.7|112/280| BL:PDB:NREP 1 BL:PDB:REP 19->114|2qlcE|2e-14|34.4|96/124| RP:PFM:NREP 1 RP:PFM:REP 19->116|PF04002|5e-23|45.9|98/123|DUF2466| HM:PFM:NREP 1 HM:PFM:REP 13->114|PF04002|2.6e-35|44.1|102/123|DUF2466| OP:NHOMO 845 OP:NHOMOORG 613 OP:PATTERN ----------------------------------------------1--1111--------------- ----------------------------------------------------------------------------------1--1111-11----1--11111112-11--------------1111121111-2-----2221--111--111--------11111111-----------------1112-111111-12-11-1111111111112122111111111112111-111111111111-111111111-1-111--1111--1-1111111111-111111111111111111111111111111111111112111111111111111112111111211-11--222211111112111-223-1211111111111111111111111111111-11111111112--11111111111121-11221121111111111112111111111111111-111--11111---11-3143-111211--13-1111-1----2211------1121111-1212132522211114211111--1111111131421-1331111-1111111-12-2124----1-11------------------------111232111121111211311132232221211---21-2------11231114337446341-32426261453531142111213222221211111211111111123221---111121111232--11-1-11-----16111111112211-111111-11-----2112121122222221111---------12311322422121411424351111111--11--------------1---------------------------1-1-111111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 78.7 SQ:SECSTR ##################HHHTTccccTTccEEEEEEEcTTccEEEEEEEEcccccGGGccHHHHHHHHHHTTccEEEEEEEcTTccccccHHHHHHHHHHHHHHHHHTcEEEE######## DISOP:02AL 1-11, 86-93| PSIPRED ccHHcccccccccHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEEEccccEEEEcHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHccEEEEEEEEEEccc //