[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03839.1
DDBJ      :             unknown
Swiss-Prot:Y1301_RICCN  RecName: Full=UPF0235 protein RC1301;

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.206.1
:105 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   41->78 1n91A PDBj 2e-04 34.2 %
:RPS:SCOP  14->103 1jrmA  d.206.1.1 * 1e-14 28.2 %
:HMM:SCOP  1->105 1jrmA_ d.206.1.1 * 2.8e-21 30.0 %
:RPS:PFM   15->88 PF02594 * DUF167 5e-07 35.7 %
:HMM:PFM   11->90 PF02594 * DUF167 9.5e-28 41.6 77/78  
:BLT:SWISS 1->105 Y1301_RICCN 5e-57 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03839.1 GT:GENE AAL03839.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1203438..1203755 GB:FROM 1203438 GB:TO 1203755 GB:DIRECTION + GB:PRODUCT unknown GB:PROTEIN_ID AAL03839.1 GB:DB_XREF GI:15620440 LENGTH 105 SQ:AASEQ MDKFYNYNSSSHQALLSFKVKPNSKQNLISNFVIINNIPYLKLSIKAIPEQGKANEEIINYLAKEWKLSRSNIEIIKGHTHSLKTILIKNINEDYLNLIINSYIK GT:EXON 1|1-105:0| SW:ID Y1301_RICCN SW:DE RecName: Full=UPF0235 protein RC1301; SW:GN OrderedLocusNames=RC1301; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->105|Y1301_RICCN|5e-57|100.0|105/105| BL:PDB:NREP 1 BL:PDB:REP 41->78|1n91A|2e-04|34.2|38/108| RP:PFM:NREP 1 RP:PFM:REP 15->88|PF02594|5e-07|35.7|70/77|DUF167| HM:PFM:NREP 1 HM:PFM:REP 11->90|PF02594|9.5e-28|41.6|77/78|DUF167| RP:SCP:NREP 1 RP:SCP:REP 14->103|1jrmA|1e-14|28.2|85/104|d.206.1.1| HM:SCP:REP 1->105|1jrmA_|2.8e-21|30.0|100/104|d.206.1.1|1/1|YggU-like| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 60.0 SQ:SECSTR ########################################EEEEccccccHHHHHHHHHHHHHHHTcccTTTEEEcccGGGcEEEEEEEcccHHHHHHHHHTc## PSIPRED cccEEEEccccccEEEEEEEccccccccEEEEEEcccccEEEEEEEccccccHHHHHHHHHHHHHHcccHHHEEEEEcccccEEEEEEccccHHHHHHHHHHHcc //