[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL03910.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:Y883_RICPR   RecName: Full=UPF0093 membrane protein RP883;

Homologs  Archaea  0/68 : Bacteria  294/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->128 PF03653 * UPF0093 2e-25 51.2 %
:HMM:PFM   1->144 PF03653 * UPF0093 6.9e-58 52.1 144/147  
:BLT:SWISS 1->145 Y883_RICPR 6e-70 95.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03910.1 GT:GENE AAL03910.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1265874..1266311) GB:FROM 1265874 GB:TO 1266311 GB:DIRECTION - GB:PRODUCT putative integral membrane protein GB:PROTEIN_ID AAL03910.1 GB:DB_XREF GI:15620517 LENGTH 145 SQ:AASEQ MASYYLWFKSFHLISAICWMAGLLYLPRIYVYHIKAKIGSELDSTLQVMELKLLRFIMNPAMISTFIFGLINAHIYGFVALDTWFHIKMFAVLILVIFHGLLARWRKDFANGKNVHSEKFYRIVNEIPAICMIVAVIMVIVKPFD GT:EXON 1|1-145:0| SW:ID Y883_RICPR SW:DE RecName: Full=UPF0093 membrane protein RP883; SW:GN OrderedLocusNames=RP883; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->145|Y883_RICPR|6e-70|95.2|145/145| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 8->30| TM:REGION 53->75| TM:REGION 83->104| TM:REGION 123->145| SEG 129->141|aicmivavimviv| RP:PFM:NREP 1 RP:PFM:REP 5->128|PF03653|2e-25|51.2|123/143|UPF0093| HM:PFM:NREP 1 HM:PFM:REP 1->144|PF03653|6.9e-58|52.1|144/147|UPF0093| OP:NHOMO 294 OP:NHOMOORG 294 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------111-------------1-11--1-1------------------------------------1111111--1111111111-1111-11111111-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111-----111111111111111111111111-111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111----1111111-11111111111111-11--1-----11-1111111111111111111--------------------------------1111111111111111111111-11-----1111111-----------------------1111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111--------------------------------------11--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 145-146| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccc //