[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : addA
DDBJ      :addA         erythrocyte adducin alpha subunit
Swiss-Prot:Y493_RICPR   RecName: Full=Putative aldolase class 2 protein RP493;

Homologs  Archaea  7/68 : Bacteria  225/915 : Eukaryota  147/199 : Viruses  0/175   --->[See Alignment]
c.74.1
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->227 2z7bA PDBj 4e-14 24.4 %
:RPS:PDB   7->202 1e4bP PDBj 3e-40 21.1 %
:RPS:SCOP  7->202 1dzuP  c.74.1.1 * 1e-41 20.5 %
:HMM:SCOP  2->209 1e4cP_ c.74.1.1 * 5.6e-50 32.8 %
:RPS:PFM   7->184 PF00596 * Aldolase_II 2e-21 35.6 %
:HMM:PFM   7->185 PF00596 * Aldolase_II 6.6e-45 39.8 171/183  
:BLT:SWISS 1->231 Y493_RICPR e-126 90.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03216.1 GT:GENE addA GT:PRODUCT erythrocyte adducin alpha subunit GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(656548..657243) GB:FROM 656548 GB:TO 657243 GB:DIRECTION - GB:GENE addA GB:PRODUCT erythrocyte adducin alpha subunit GB:PROTEIN_ID AAL03216.1 GB:DB_XREF GI:15619768 GB:GENE:GENE addA LENGTH 231 SQ:AASEQ MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQYNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYHNYNSLVLDADKQSSRLVTDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKDLLSFEEDLGKRDWAAWLRLVKM GT:EXON 1|1-231:0| SW:ID Y493_RICPR SW:DE RecName: Full=Putative aldolase class 2 protein RP493; SW:GN OrderedLocusNames=RP493; SW:KW Complete proteome; Metal-binding; Zinc. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->231|Y493_RICPR|e-126|90.9|231/231| GO:SWS:NREP 1 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| BL:PDB:NREP 1 BL:PDB:REP 7->227|2z7bA|4e-14|24.4|213/233| RP:PDB:NREP 1 RP:PDB:REP 7->202|1e4bP|3e-40|21.1|190/206| RP:PFM:NREP 1 RP:PFM:REP 7->184|PF00596|2e-21|35.6|177/181|Aldolase_II| HM:PFM:NREP 1 HM:PFM:REP 7->185|PF00596|6.6e-45|39.8|171/183|Aldolase_II| GO:PFM:NREP 1 GO:PFM GO:0046872|"GO:metal ion binding"|PF00596|IPR001303| RP:SCP:NREP 1 RP:SCP:REP 7->202|1dzuP|1e-41|20.5|190/209|c.74.1.1| HM:SCP:REP 2->209|1e4cP_|5.6e-50|32.8|201/206|c.74.1.1|1/1|AraD-like aldolase/epimerase| OP:NHOMO 819 OP:NHOMOORG 379 OP:PATTERN ------1---------1-----------------1---11------------------1----1---- --1-1---------1---------11-----1------21-1-1--------------11-1-1---111------------------------------------------------------------------------------------------------1111------------------11--------------1---1--------------------------------------------------------------------------------11111111111-----------------------1----1111111-1--1---------------111-1---------1----1-3111-----1-345--11-13---------------3--2-3-22-2------111-13-121-1-----11111111111111---1---------11--1111-11111-111-11-1151-222233444432222233663333235154354-1332-11--2-5153111-----------------2-----------------------------1---------------------------------2--1-31-------1-------------------------------------------------------------1332--1--1-111-1111111111------------------------------------1-14-------1111----11-11-2---2-1111-2341352-1111-11111111----------------------------------------------------------------------------1----1------ ----11---------4432422354333322232122222222222321114A3112--111121-12-1--3-1-----122232-----1412---1-211111--4154644743131333A8382JRA-866333161242132334239232341311112162255732---1-111-1---13---1----3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 97.0 SQ:SECSTR #HHHHHHHHHHHHHHHTTcccTTccEEEEEETTETEEEEccccccGGGccGGGcEEEcTTccccTTccccTccTTHHHHHHHHHHcTTccEEEEEccHHHHHHHHHTcccccccGGGGGGTcccccEEccccTTcHHHHHHHHHHHTccccEEEETTTEEEEEEccHHHHHHHHHHHHHHHHHHHHHHTTccccccccHHHH##HHHTTcccTHHHHHHHHHHHHHH#### DISOP:02AL 231-232| PSIPRED cHHHHHHHHHHHHHHHcccccccccEEEEEEccccEEEEEcccccHHHccHHHEEEEccccccccccccccccHHHHHHHHHHHHcccccEEEEEccHHHHHHHHcccccccccHHHHHHcccEEEEcccccccccHHHHHHHHHHcccccEEEEcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcc //