[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : cmk
DDBJ      :cmk          cytidylate kinase
Swiss-Prot:KCY_RICCN    RecName: Full=Cytidylate kinase;         Short=CK;         EC=2.7.4.14;AltName: Full=Cytidine monophosphate kinase;         Short=CMP kinase;

Homologs  Archaea  0/68 : Bacteria  831/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->210 2h92A PDBj 3e-27 37.3 %
:RPS:PDB   17->218 1ckeA PDBj 5e-19 36.2 %
:RPS:SCOP  13->210 1q3tA  c.37.1.1 * 3e-32 37.6 %
:HMM:SCOP  13->217 1ckeA_ c.37.1.1 * 3e-37 30.7 %
:RPS:PFM   83->210 PF02224 * Cytidylate_kin 3e-29 52.8 %
:HMM:PFM   80->211 PF02224 * Cytidylate_kin 1.9e-52 50.4 131/158  
:HMM:PFM   33->96 PF06973 * DUF1297 0.00014 22.6 62/188  
:BLT:SWISS 1->219 KCY_RICCN e-119 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03286.1 GT:GENE cmk GT:PRODUCT cytidylate kinase GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(715367..716026) GB:FROM 715367 GB:TO 716026 GB:DIRECTION - GB:GENE cmk GB:PRODUCT cytidylate kinase GB:PROTEIN_ID AAL03286.1 GB:DB_XREF GI:15619843 GB:GENE:GENE cmk LENGTH 219 SQ:AASEQ MVDLKTKAFDISQNFTISLDGPAASGKGTIGLILAKKFSLKYFQSSIVYRQLAFDCISQKIDVTDIDAVIALSKELKLDNNFDLENENIGNIASQIAVISEIRNNLNKYLISLVKTTPRMIMEGRDIGTVVAPDADLKIFITANPQIRAERRYKQLQAKGKTCILDEILRQIILRDKRDKERKAAPLLPASDALIIDTSKLSAMEVVEEVTNYIKNKIT GT:EXON 1|1-219:0| SW:ID KCY_RICCN SW:DE RecName: Full=Cytidylate kinase; Short=CK; EC=2.7.4.14;AltName: Full=Cytidine monophosphate kinase; Short=CMP kinase; SW:GN Name=cmk; OrderedLocusNames=RC0748; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->219|KCY_RICCN|e-119|100.0|219/219| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 17->210|2h92A|3e-27|37.3|193/216| RP:PDB:NREP 1 RP:PDB:REP 17->218|1ckeA|5e-19|36.2|188/212| RP:PFM:NREP 1 RP:PFM:REP 83->210|PF02224|3e-29|52.8|127/156|Cytidylate_kin| HM:PFM:NREP 2 HM:PFM:REP 80->211|PF02224|1.9e-52|50.4|131/158|Cytidylate_kin| HM:PFM:REP 33->96|PF06973|0.00014|22.6|62/188|DUF1297| GO:PFM:NREP 3 GO:PFM GO:0004127|"GO:cytidylate kinase activity"|PF02224|IPR011994| GO:PFM GO:0005524|"GO:ATP binding"|PF02224|IPR011994| GO:PFM GO:0006139|"GO:nucleobase, nucleoside, nucleotide and nucleic acid metabolic process"|PF02224|IPR011994| RP:SCP:NREP 1 RP:SCP:REP 13->210|1q3tA|3e-32|37.6|197/223|c.37.1.1| HM:SCP:REP 13->217|1ckeA_|3e-37|30.7|202/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 842 OP:NHOMOORG 838 OP:PATTERN -------------------------------------------------------------------- 111--11111111111111-1111111111111---11111111--1111--1-111111-1111111111--11---11111111111111-111---1111111111111111111111111111111-1111----11---1-11111111111-1111-11111111111111111111-11--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211-11111111111111111111111111111111111-11-111111111111111111111111111111111111111111111111111111111111----1111111111111----1111111111111111111111111111111111111111111111111111111111-2111111111111111111111-111111111111111111111111111-------------------------11111-111111111111111111111111111-11111-1----11111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111-111111-11111111111111111111111111111111 --------------1----------------------------------------------------------------------------------------1111---------------------------------------------------------------2-----------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 95.4 SQ:SECSTR #########GGGccEEEEEEccTTccHHHHHHHHHHHHTcEEEEHHHHHHHHHHHHHHHTccTTcHHHHHHHHHTccEEEEEETTEEEEEHHHHHHTTcHHHHHHHHHHHHTTccTHTcEEEEEccccccccTTccEEEEEEccHHHHHHHHHHHHHHHTccccHHHHHHHHHTTcccccHHHHHcccccTTcEEEETTTccHHHHHHHHHHHHHHHH# DISOP:02AL 1-6| PSIPRED ccccccccccccccEEEEEEccccccHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccEEEEEcccccEEEEEEccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccHHHHHHHHHHHHHHHcc //