[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : cyaY
DDBJ      :cyaY         cyaY protein
Swiss-Prot:CYAY_RICCN   RecName: Full=Protein cyaY;

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
d.82.2
:103 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->94 1xaqA PDBj 8e-12 50.0 %
:RPS:PDB   1->101 1ekgA PDBj 2e-23 33.7 %
:RPS:SCOP  1->99 2fqlA1  d.82.2.1 * 2e-25 35.4 %
:HMM:SCOP  1->105 1ew4A_ d.82.2.1 * 9.7e-29 43.3 %
:RPS:PFM   3->95 PF01491 * Frataxin_Cyay 3e-15 50.5 %
:HMM:PFM   1->100 PF01491 * Frataxin_Cyay 2.9e-30 46.0 100/109  
:BLT:SWISS 1->103 CYAY_RICCN 2e-56 100.0 %
:PROS 49->63|PS01344|FRATAXIN_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02981.1 GT:GENE cyaY GT:PRODUCT cyaY protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 437709..438020 GB:FROM 437709 GB:TO 438020 GB:DIRECTION + GB:GENE cyaY GB:PRODUCT cyaY protein GB:PROTEIN_ID AAL02981.1 GB:DB_XREF GI:15619514 GB:GENE:GENE cyaY LENGTH 103 SQ:AASEQ MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYHFFYEQGEWTNRAGLELMAILTEELNIKFDTRPT GT:EXON 1|1-103:0| SW:ID CYAY_RICCN SW:DE RecName: Full=Protein cyaY; SW:GN Name=cyaY; OrderedLocusNames=RC0443; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->103|CYAY_RICCN|2e-56|100.0|103/103| PROS 49->63|PS01344|FRATAXIN_1|PDOC01043| BL:PDB:NREP 1 BL:PDB:REP 31->94|1xaqA|8e-12|50.0|64/123| RP:PDB:NREP 1 RP:PDB:REP 1->101|1ekgA|2e-23|33.7|101/119| RP:PFM:NREP 1 RP:PFM:REP 3->95|PF01491|3e-15|50.5|93/107|Frataxin_Cyay| HM:PFM:NREP 1 HM:PFM:REP 1->100|PF01491|2.9e-30|46.0|100/109|Frataxin_Cyay| RP:SCP:NREP 1 RP:SCP:REP 1->99|2fqlA1|2e-25|35.4|99/112|d.82.2.1| HM:SCP:REP 1->105|1ew4A_|9.7e-29|43.3|104/106|d.82.2.1|1/1|Frataxin/Nqo15-like| OP:NHOMO 117 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111-----------------------------1-------------------------------------------------------------------------------------------------------------------------1-----1------1-------------------1111-----------------------------------1-111-1-------11----11---------111111111111-------------------11-1------1--1---------------------------------------1111-----11-11------------------------------------------------------------------------- --------21-----1-11------------------------------111111111-111111111-1---1-111111---1--1-1-------1---1--------21-1-2--------1---------------1---------------111---12----------1-11--1-1-----1111--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 98.1 SQ:SECSTR ccHHHHHHHHHHHHHHHHHHHHHHTTcTTcEEEEETTEEEEcTTccEEEEEEEGGGTEEEEEETTTEEEEEEEccccEETTTcccHHHHHHHHHHHHHTcc## DISOP:02AL 103-104| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccEEEEEEcccEEEEEccccHHHHHHHccccccEEEEEEccEEEEcccHHHHHHHHHHHHHHHccccc //