[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : def2
DDBJ      :def2         polypeptide deformylase
Swiss-Prot:DEFL_RICCN   RecName: Full=Peptide deformylase-like;AltName: Full=Polypeptide deformylase-like;

Homologs  Archaea  1/68 : Bacteria  798/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
d.167.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->159 1s17A PDBj 8e-31 43.0 %
:RPS:PDB   3->159 3cpmA PDBj 1e-49 31.2 %
:RPS:SCOP  9->159 1bs4A  d.167.1.1 * 2e-45 38.9 %
:HMM:SCOP  6->173 1y6hA_ d.167.1.1 * 1.1e-51 41.1 %
:RPS:PFM   10->157 PF01327 * Pep_deformylase 1e-29 41.9 %
:HMM:PFM   8->158 PF01327 * Pep_deformylase 2.2e-46 40.4 151/157  
:BLT:SWISS 1->183 DEFL_RICCN 5e-93 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03212.1 GT:GENE def2 GT:PRODUCT polypeptide deformylase GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 655152..655703 GB:FROM 655152 GB:TO 655703 GB:DIRECTION + GB:GENE def2 GB:PRODUCT polypeptide deformylase GB:PROTEIN_ID AAL03212.1 GB:DB_XREF GI:15619763 GB:GENE:GENE def2 LENGTH 183 SQ:AASEQ MNQDKPYYQIVYAPNDIFKKQAEYIDIVDDNIRTIVDKMLQNLHIERAVGLGANMVGILKRIAVVDLHENNKSSPIVFINPNITYFSEEKQTFIEGSLSFPGIEASITRSKAIKVKYLDYNGNKQELAAEGFLATVIQHEIEYLNGKTFLDSLSKLKRDTLLKKMLKHIKLHPPHIHGSGCRH GT:EXON 1|1-183:0| SW:ID DEFL_RICCN SW:DE RecName: Full=Peptide deformylase-like;AltName: Full=Polypeptide deformylase-like; SW:GN OrderedLocusNames=RC0674; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->183|DEFL_RICCN|5e-93|100.0|183/183| SEG 161->175|llkkmlkhiklhpph| BL:PDB:NREP 1 BL:PDB:REP 10->159|1s17A|8e-31|43.0|149/166| RP:PDB:NREP 1 RP:PDB:REP 3->159|3cpmA|1e-49|31.2|157/184| RP:PFM:NREP 1 RP:PFM:REP 10->157|PF01327|1e-29|41.9|148/155|Pep_deformylase| HM:PFM:NREP 1 HM:PFM:REP 8->158|PF01327|2.2e-46|40.4|151/157|Pep_deformylase| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF01327|IPR000181| GO:PFM GO:0006412|"GO:translation"|PF01327|IPR000181| GO:PFM GO:0042586|"GO:peptide deformylase activity"|PF01327|IPR000181| RP:SCP:NREP 1 RP:SCP:REP 9->159|1bs4A|2e-45|38.9|149/168|d.167.1.1| HM:SCP:REP 6->173|1y6hA_|1.1e-51|41.1|168/0|d.167.1.1|1/1|Peptide deformylase| OP:NHOMO 1207 OP:NHOMOORG 846 OP:PATTERN ---------------------------------------------1---------------------- 12112112222111----------------------111-11-12--12222332212---1--12322111111---11221122221111-1111-1-11111211111111111111111121111111111111111111212222222221111112111112222121111121111111--1111111111111111111111111121111112-2211111-3111111111111111121122--11--1-1-2------1-1----------------11111111111--------------11---111-11323333332223121442332111111231111121111111111111-11111111111212111111111122222221222-22222222112122222222222222111232333323322222222122221222232222211113333133331331111111111122222222222222222222222222222222212222122221221213311111111111111111122111111111111111222222222111132111111111111111111111111111222111112121222222222333323223221-1112111111111111111111111121-1111111111111111111112112121111111111111111111111111111111111111111111111-2333211111111111111111112222212111111222222112222122211111111111112222221212211222221111111112111111111-1111111------------11--------1---1111111111111 11------1--------------------------------------------------------------------------------------------------1212-1----------1---1-131--11-------2---------1----1------2-2117--1111129111112113-31-221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 86.9 SQ:SECSTR TTccccccccccTTcGGGTccccccccccHHHHHHHHHHHHHHHHTTccEEEGGGGTccccEEEEccccTTccccEEEEEEEEEEEcccEEEEEEccTTcTTccEEEEEEccEEEEEEcTTccEEEEEEcHHHHHHHHHHHHHHTTccGGGGccHHHHH######################## DISOP:02AL 1-3, 176-183| PSIPRED ccccccccEEEEcccHHHcccccccccccHHHHHHHHHHHHHHHHccccEEEEccccccEEEEEEEcccccccccEEEEccEEEEccccEEEEccccEEccccEEEEccccEEEEEEEcccccEEEEEEcccEEEEEEEEHHHcccEEEEEEccHHHHHHHHHHHHHHHHccccccccccccc //