[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : dinJ
DDBJ      :dinJ         DNA-damage-inducible protein J
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  77/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->50 2k29A PDBj 1e-04 34.1 %
:RPS:PFM   7->69 PF04221 * RelB 6e-10 52.4 %
:HMM:PFM   5->72 PF04221 * RelB 1e-25 45.6 68/83  
:BLT:SWISS 1->72 DINJ_ECOLI 3e-17 56.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03882.1 GT:GENE dinJ GT:PRODUCT DNA-damage-inducible protein J GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1247038..1247301 GB:FROM 1247038 GB:TO 1247301 GB:DIRECTION + GB:GENE dinJ GB:PRODUCT DNA-damage-inducible protein J GB:PROTEIN_ID AAL03882.1 GB:DB_XREF GI:15620487 GB:GENE:GENE dinJ LENGTH 87 SQ:AASEQ MSADSIVRARINEDVKEEAALVLAAMGLTLSDAVRMLLFRVAREKALPFEPLIPNDETIKAMKAARSGKLVHVGNINNLLSDLNENN GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 1->72|DINJ_ECOLI|3e-17|56.9|72/86| BL:PDB:NREP 1 BL:PDB:REP 7->50|2k29A|1e-04|34.1|44/50| RP:PFM:NREP 1 RP:PFM:REP 7->69|PF04221|6e-10|52.4|63/81|RelB| HM:PFM:NREP 1 HM:PFM:REP 5->72|PF04221|1e-25|45.6|68/83|RelB| OP:NHOMO 90 OP:NHOMOORG 77 OP:PATTERN -------------------------------------------------------------------- 1-----------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----72-3-----1---------1---1-11---1-1121---1--111--1------------------------------------------------1----1111-11--------1--------------------------------11---------11-11--3--1---------------1----1-------------------------------------------------------11--------------------------------------------------111-1---11-11111--1111--11111-------2---1-1-1-1---1------1---1--1-------------1----------------------------------------1----------------1-----------------------------------11-1----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 44 STR:RPRED 50.6 SQ:SECSTR ######ccccccHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHcccccc##################################### DISOP:02AL 1-2, 86-87| PSIPRED cccccEEEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccHHHHHHHHcccc //